Dbfetch

ID   BC129912; SV 1; linear; mRNA; STD; MUS; 2550 BP.
XX
AC   BC129912;
XX
DT   03-JAN-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus nuclear receptor subfamily 3, group C, member 1, mRNA (cDNA
DE   clone MGC:150307 IMAGE:40111802), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2550
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2550
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6c6328bd6f72f91e069367f216af1539.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 28 Row: p Column: 7.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2550
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:150307 IMAGE:40111802"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: CACACAAT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..2550
FT                   /gene="Nr3c1"
FT                   /note="synonym: GR"
FT   misc_difference 1
FT                   /gene="Nr3c1"
FT                   /note="1 base at the 5' end does not align to the mouse
FT                   genome."
FT   misc_difference 3
FT                   /gene="Nr3c1"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   CDS             19..2370
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /product="Nr3c1 protein"
FT                   /db_xref="GOA:Q3U2M7"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001409"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:95824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2M7"
FT                   /protein_id="AAI29913.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   QHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQD
FT                   TSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQ
FT                   VIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLII
FT                   NEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDE
FT                   IRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSI
FT                   EFPEMLAEIITNQIPKYSNGNIKKLLFHQK"
XX
SQ   Sequence 2550 BP; 736 A; 572 C; 599 G; 643 T; 0 other;
     ggaagttaat atttgccaat ggactccaaa gaatccttag ctccccctgg tagagacgaa        60
     gtccccagca gtttgcttgg ccgggggagg ggaagcgtga tggacttgta taaaaccctg       120
     aggggtggag ctacagtcaa ggtttctgcg tcttcaccct cagtggctgc tgcttctcag       180
     gcagattcca agcagcagag gattctcctt gatttttcaa aaggctcagc aagcaatgca       240
     cagcagcagc agcagcagca gcagccgcag ccagatttat ccaaagccgt ttcactgtcc       300
     atgggactgt atatgggaga gaccgaaaca aaagtgatgg ggaatgactt gggctaccca       360
     cagcagggcc agcttggcct ctcctctggg gaaacagact ttcggcttct ggaagaaagc       420
     attgcaaacc tcaataggtc gaccagccgt ccagagaatc ccaagagttc aacacctgca       480
     gctgggtgtg ctaccccgac agagaaggag tttccccaga ctcactctga tccatcttca       540
     gaacagcaaa atagaaaaag ccagcctggc accaacggtg gcagtgtgaa attgtatacc       600
     acagaccaaa gcacctttga catcttgcag gatttggagt tttctgccgg gtccccaggt       660
     aaagagacaa acgagagtcc ttggaggtca gacctgttga tagatgaaaa cttgctttct       720
     cctttggcgg gagaagatga tccattcctt ctggaagggg acgtgaatga ggattgcaag       780
     cctcttattt taccggacac taaacctaaa attcaggata ctggagatac aatcttatca       840
     agccccagca gtgtggcact gccccaagtg aaaacagaga aagatgattt cattgagctt       900
     tgcacccctg gggtaattaa gcaagagaaa ctgggcccgg tttattgcca ggcaagcttt       960
     tctgggacaa atataattgg gaataaaatg tctgccattt ctgttcatgg cgtgagtacc      1020
     tctggaggac agatgtacca ctatgacatg aatacagcat ccctttctca gcagcaggat      1080
     cagaagcctg tttttaatgt cattccacca attcctgttg gttctgaaaa ctggaatagg      1140
     tgccaagggt ctggagagga caacctgact tccttggggg ctatgaactt cgcaggccgc      1200
     tcagtgtttt ctaatggata ttcaagccct ggaatgagac cagatgtgag ttctcctccg      1260
     tccagctcct ccacagcaac gggaccacct cccaaactct gcctggtgtg ctccgatgaa      1320
     gcttcgggat gccattatgg ggtgctgacg tgtggaagct gtaaagtctt ctttaaaaga      1380
     gcagtggaag gacagcacaa ttacctttgt gctggaagaa atgattgcat cattgataaa      1440
     attcgaagaa aaaactgtcc agcatgccgc tatcgaaaat gtcttcaagc tggaatgaac      1500
     ctggaagctc gaaaaacgaa gaaaaaaatt aaaggaattc agcaagccac tgcaggagtc      1560
     tcacaagaca cttctgaaaa cgctaacaaa acaatagttc ctgccgcgct gccacagctt      1620
     acccctaccc tggtgtcact gctggaggtg atcgagcctg aggtgttata tgcaggatat      1680
     gacagctctg ttccagactc agcatggaga attatgacca cgctcaacat gttaggtggg      1740
     cgccaagtga ttgccgcagt gaaatgggca aaggcgatac caggattcag aaacttacac      1800
     ctggatgacc aaatgaccct tctacagtac tcatggatgt ttctcatggc atttgccctg      1860
     ggttggagat catacagaca agcaagtgga aacctgctat gctttgctcc tgatctgatt      1920
     attaatgagc agagaatgac tctaccctgc atgtatgacc aatgtaaaca catgctgttt      1980
     atctccactg aattacaaag attgcaggta tcctatgaag agtatctctg tatgaaaacc      2040
     ttactgcttc tctcctcagt tcctaaggaa ggtctgaaga gccaagagtt atttgatgag      2100
     attcgaatga cttatatcaa agagctagga aaagccattg tcaaaaggga aggaaactcc      2160
     agtcagaatt ggcagcggtt ttatcaactg acaaaacttt tggactccat gcatgatgtg      2220
     gttgaaaatc tccttagcta ctgcttccaa acatttttgg ataagtccat gagtattgaa      2280
     ttcccagaga tgttagctga aatcatcact aatcagatac caaaatactc aaatggaaat      2340
     atcaaaaagc ttctgtttca tcagaaatga ctgccttact aagaaaggct gccttaaaga      2400
     aagttgaatt tatagctttt actgtacaaa cttatcaact tgtcttgtag atgttttgtc      2460
     gttctttttg tttgtcttgt ttgttttcta tacgcactac atgtggtctc tagagggcca      2520
     agacttggca acagaagcag atgagccatc                                       2550
//