Dbfetch

ID   BC129855; SV 1; linear; mRNA; STD; MUS; 2822 BP.
XX
AC   BC129855;
XX
DT   17-FEB-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus glutamate receptor, ionotropic, AMPA3 (alpha 3), mRNA (cDNA
DE   clone MGC:150062 IMAGE:40109751), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2822
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2822
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4bdffd8bbb9c155f197d89226cad78fc.
DR   Ensembl-Gn; ENSMUSG00000001986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076349; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 28 Row: h Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2822
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:150062 IMAGE:40109751"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: AGCCCACA sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..2822
FT                   /gene="Gria3"
FT                   /note="synonym: mKIAA4184"
FT   CDS             55..2721
FT                   /codon_start=1
FT                   /gene="Gria3"
FT                   /product="Gria3 protein"
FT                   /db_xref="GOA:Q9Z2W9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95810"
FT                   /db_xref="PDB:3LSW"
FT                   /db_xref="PDB:3LSX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W9"
FT                   /protein_id="AAI29856.1"
FT                   /translation="MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAF
FT                   RFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSM
FT                   NTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTER
FT                   GFSILQAIMEAAVQNNWQVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINT
FT                   ILEQVVILGKHSRGYHYMLANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRW
FT                   VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAV
FT                   PWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERF
FT                   VPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAK
FT                   HVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK
FT                   PFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH
FT                   LEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
FT                   LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE
FT                   KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNL
FT                   DSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSA
FT                   LSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNY
FT                   ATYREGYNVYGTESVKI"
XX
SQ   Sequence 2822 BP; 819 A; 608 C; 687 G; 708 T; 0 other;
     cgcccatgct cttgtcagct tcgttttagg cgtagcacag ccaggcagaa gaaaatgggg        60
     caaagcgtgc tccgggcggt cttcttttta gtcctggggc ttttgggtca ttctcacgga       120
     ggattcccca acaccatcag cataggtgga cttttcatga gaaacacggt acaggagcac       180
     agtgctttcc gctttgctgt gcagttatac aacaccaacc agaacaccac tgagaagccc       240
     ttccatttga actaccacgt agaccacttg gattcctcca atagtttttc tgtgactaat       300
     gctttctgct cccagttctc cagaggggtg tatgctatct ttggattcta tgaccagatg       360
     tcaatgaaca cactgacctc cttctgtggg gccctgcata catctttcgt cacacctagc       420
     tttcccactg atgccgatgt gcagtttgtc atccagatgc gcccagcctt aaagggtgcc       480
     attctgagtc ttctgggtta ctacaagtgg gagaagtttg tgtacctcta tgacacagaa       540
     cgagggtttt ccatcctgca agcaattatg gaagcagcag tgcaaaacaa ctggcaagtg       600
     acagcaaggt ctgtgggaaa cataaaggac atccaggaat tcagacgcat cattgaagaa       660
     atggacagaa ggcaggaaaa acgatacttg attgactgtg aagtcgaaag gattaacaca       720
     attttggaac aggttgtgat cctggggaaa cattcaagag gttatcacta catgcttgct       780
     aacctgggtt ttactgacat tgtactggaa agagtcatgc atgggggagc caacattaca       840
     ggtttccaga ttgtcaacaa tgaaaaccca atggtccagc aattcataca gcgctgggtg       900
     agactggatg aaagggaatt ccctgaagcc aagaatgcac cactaaagta tacatctgca       960
     ctgacacacg acgcaatact ggtcatagca gaagccttcc gatacctgag gaggcagcga      1020
     gtggatgtat cccgcagagg cagtgctgga gactgcttag caaatcctgc tgtgccctgg      1080
     agtcaaggaa ttgatattga gagagctctg aaaatggtgc aagtacaagg aatgactgga      1140
     aacatccaat ttgacactta tggacgtagg acaaattata ccattgatgt atatgaaatg      1200
     aaagtctcag gctctcgaaa agctggttac tggaatgagt atgaaaggtt tgtgcccttc      1260
     tcagatcaac aaatcagcaa tgacagctca tcctccgaga acaggaccat cgtagtgact      1320
     accattctgg aatcaccata tgtaatgtat aaaaagaatc atgagcaact ggaaggaaat      1380
     gagcgctatg aaggctattg tgtcgattta gcctatgaaa tagccaaaca cgtaaggatc      1440
     aaatacaaat tgtccattgt cggtgatggg aaatatggcg caagggatcc agagactaaa      1500
     atatggaatg gcatggttgg ggaacttgtc tatggaagag ctgatatagc tgttgctcca      1560
     ctcactataa cattggtccg tgaagaagtc atagattttt caaagccatt tatgagcctg      1620
     gggatctcca tcatgataaa gaagcctcag aaatcaaagc caggcgtatt ttcattcctg      1680
     gatcctttag cttatgaaat ctggatgtgc attgtcttcg cttacattgg agtcagtgta      1740
     gttctcttcc tagtcagcag atttagccct tatgagtggc acttggaaga caacaatgaa      1800
     gaacctcgtg acccacaaag ccctcctgat cctcccaatg aatttggaat atttaacagt      1860
     ctttggtttt ccttgggtgc ttttatgcag caaggatgtg atatttctcc aagatcactt      1920
     tctgggcgca ttgttggagg ggtttggtgg ttcttcaccc tgatcataat ctcttcctac      1980
     actgcaaacc ttgctgcttt cctgactgtg gagaggatgg tgtcccccat agagagcgct      2040
     gaagatttag ccaagcagac tgaaattgca tacgggaccc tggactctgg ttcaacaaaa      2100
     gaatttttca gaagatccaa aattgctgtg tatgagaaaa tgtggtctta catgaaatcc      2160
     gcagagccat ctgtgtttac caaaacaaca gctgatgggg tagcccgagt tcggaagtcc      2220
     aagggaaagt tcgccttcct gctggagtca accatgaatg agtacattga gcagagaaag      2280
     ccgtgtgata cgatgaaagt tggtggaaat ctggattcca aaggctatgg tgtggcaacc      2340
     cctaaaggct cagcattaag aacgcctgta aaccttgcag tattgaaact cagtgaacaa      2400
     ggcatcttag acaagctgaa aaacaaatgg tggtacgata agggggaatg tggagccaag      2460
     gactccggga gtaaggacaa gaccagtgct ctaagcctga gcaatgtggc aggcgtgttc      2520
     tatatacttg tcggaggtct ggggctggcc atgatggtgg ctttgataga attctgttac      2580
     aaatcacggg cagagtccaa acgcatgaaa ctcacaaaga acacccaaaa ctttaagcct      2640
     gctcctgcca ccaacactca gaattacgct acatacagag aaggctacaa cgtgtatgga      2700
     acagaaagtg ttaagatcta gggatccctt cccaccggaa gcatgcaatg agaggaaatc      2760
     actgaaaacg tggctgcttc aaggatcctg agccagattt cactctcctt ggtgtcgggc      2820
     at                                                                     2822
//