spacer

EBI Dbfetch

ID   BC128466; SV 1; linear; mRNA; STD; MUS; 1071 BP.
XX
AC   BC128466;
XX
DT   07-DEC-2006 (Rel. 90, Created)
DT   07-DEC-2006 (Rel. 90, Last updated, Version 1)
XX
DE   Mus musculus chemokine (C-C motif) receptor 1-like 1, mRNA (cDNA clone
DE   MGC:156359 IMAGE:40051965), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1071
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1071
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 76432571b06f029a642457fa002cdb24.
DR   Ensembl-Gn; ENSMUSG00000064039; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071404; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 11 Row: e Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1071
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:156359 IMAGE:40051965"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TTATAACT sequenced from
FT                   the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1071
FT                   /gene="Ccr1l1"
FT   CDS             1..1071
FT                   /codon_start=1
FT                   /gene="Ccr1l1"
FT                   /product="chemokine (C-C motif) receptor 1-like 1"
FT                   /db_xref="GOA:P51676"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002236"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104617"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51676"
FT                   /protein_id="AAI28467.1"
FT                   /translation="MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVLTPLYSLV
FT                   FIIGVIGHVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGN
FT                   AMCKFVSGFYYLGLYSDMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAA
FT                   LVSIPCLYVFKSQMEFTYHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTR
FT                   IINVLHRRPNKKKAKVMRLIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVD
FT                   LSLMITEALAYTHCCVNPVIYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSVDRAQRA
FT                   SATPPSTVEIETSADL"
XX
SQ   Sequence 1071 BP; 236 A; 270 C; 229 G; 336 T; 0 other;
     atggagattc cagctgtcac agagccctcc tacaacacag ttgccaagaa tgacttcatg        60
     tctggattct tatgcttcag cataaatgtg agggcatttg gaatcacagt gctgactccc       120
     ctgtactccc tggtgttcat cattggcgtg ataggccatg tcttggtggt tctggtgctc       180
     atacaacaca agaggcttcg aaacatgacc agcatctacc tgttcaacct ggctatctct       240
     gatctggtct tcctctccac attacctttc tgggttgact atatcatgaa aggagactgg       300
     atttttggta acgccatgtg taagtttgtg tctggatttt attacctggg cttgtatagt       360
     gacatgtttt tcatcaccct gcttacgatt gatagatacc tagctgttgt ccatgtcgtg       420
     tttgccctga gagcccggac tgtcactttt ggcatcatca gtagcatcat tacctgggtc       480
     ctggctgcct tggtttctat tccttgtctc tatgttttca aatcccagat ggagttcact       540
     taccatacct gcagagcaat tttgcccagg aagagcctga tacgtttttt aaggtttcag       600
     gctctaacaa tgaacatcct tgggctaatt ttgcctctgt tggccatgat tatctgctac       660
     acacggatca tcaatgtttt acacagaaga cccaataaga agaaggccaa agtcatgcgc       720
     ctgatttttg ttattacgct tctcttcttc ctcctcttgg ccccttatta tctggctgcc       780
     tttgtttctg cttttgaaga cgtcctattc acccctagtt gtttgagaag ccaacaggtg       840
     gacctgtcct tgatgataac tgaagcactt gcctacaccc actgctgtgt caacccagtc       900
     atttatgtct ttgtgggtaa acggttccgg aagtacctct ggcagttgtt tcggaggcat       960
     acagctataa ccctgccaca atggctgccc ttcctctcgg tggacagagc acagagggcc      1020
     agtgccacgc ctccatccac agtggaaatt gagacctctg ccgacttata a               1071
//


spacer
spacer