Dbfetch

ID   BC128375; SV 1; linear; mRNA; STD; MUS; 2393 BP.
XX
AC   BC128375;
XX
DT   07-DEC-2006 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus IL2-inducible T-cell kinase, mRNA (cDNA clone MGC:150291
DE   IMAGE:40111688), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2393
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2393
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d15b3dd3c858d1743763bbcf3909da8a.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 28 Row: o Column: 22.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2393
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:150291 IMAGE:40111688"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: CGACTTAA sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..2393
FT                   /gene="Itk"
FT                   /note="synonyms: Emt, Tsk"
FT   CDS             32..1888
FT                   /codon_start=1
FT                   /gene="Itk"
FT                   /product="IL2-inducible T-cell kinase"
FT                   /db_xref="GOA:A1A560"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:96621"
FT                   /db_xref="UniProtKB/TrEMBL:A1A560"
FT                   /protein_id="AAI28376.1"
FT                   /translation="MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRH
FT                   GKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDCESRQRWVLT
FT                   LKEETRNNNSLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDPSKNASKKPLPPTPEDN
FT                   RRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPS
FT                   SYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAI
FT                   ISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSWR
FT                   QKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEE
FT                   DFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLL
FT                   GMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTK
FT                   FPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLY
FT                   KPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL"
FT   misc_difference 601
FT                   /gene="Itk"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 835
FT                   /gene="Itk"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2058
FT                   /gene="Itk"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2277
FT                   /gene="Itk"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
XX
SQ   Sequence 2393 BP; 645 A; 615 C; 592 G; 541 T; 0 other;
     cccaaggcgc atcacttttc agaactggac catgaacaac ttcatcctcc tggaagaaca        60
     gctgatcaag aagtcccaac agaagagaag gacttctccc tcgaatttta aagttcgttt       120
     ctttgtctta acgaaagcca gcctggccta ctttgaggac cgccacggga agcgcacgtt       180
     gaagggctcc attgaactct ccagaatcaa gtgtgtggag attgtcaaga gtgacattag       240
     catcccgtgc cactataaat acccttttca ggtcgtgcat gacaactatc tcctgtatgt       300
     gtttgctcca gactgtgaga gtcggcagcg ctgggtgctg acccttaaag aagaaacgag       360
     gaataacaac agcctggtat ccaagtatca ccctaatttc tggatggatg ggcggtggag       420
     gtgctgctcc cagctggaga agcctgctgt aggctgtgct ccctacgacc catccaagaa       480
     tgcttcaaag aagcctcttc ctcctactcc tgaagacaac aggcggtcat ttcaggaacc       540
     tgaagaaacc ctggtcattg ccttgtacga ctaccaaacc aacgaccctc aggagctcgc       600
     gctgcggtgt gatgaagagt actacctgct ggacagctcc gagatccact ggtggagggt       660
     tcaagacaaa aatgggcatg aaggatatgc accaagcagt tacctggtag aaaaatctcc       720
     aaataacctt gaaacctatg agtggtacaa taaaagcatc agccgcgaca aagctgaaaa       780
     acttcttttg gacacaggta aagaaggagc tttcatggtc cgagattcca ggacgcccgg       840
     gacatacaca gtctctgttt tcaccaaggc catcataagt gagaacccct gtataaaaca       900
     ttatcacatc aaagaaacaa atgacagccc caagcgctac tacgtggctg agaagtatgt       960
     gtttgactcc atccctctcc tcatccagta tcaccagtac aatggaggag gtttggtcac      1020
     tcgactccgc tatccagttt gctcctggag acaaaaagcc cctgtcacag cagggctaag      1080
     atatgggaag tgggtgatcc aaccctcaga gctaacgttc gtgcaggaga ttggcagcgg      1140
     gcagtttggg ctggtgcatc tcggctactg gctcaacaag gacaaggtgg ccatcaagac      1200
     cattcaggaa ggggcgatgt cagaagaaga ctttatcgag gaggcggaag tcatgatgaa      1260
     actctctcac cccaaactgg tgcagctcta tggggtgtgc ctggagcaag cccccatctg      1320
     cctggtgttt gagttcatgg agcacggctg cctgtcggat taccttcgaa gtcagcgggg      1380
     tctctttgct gcggagaccc tgctgggcat gtgcctggat gtgtgtgagg gcatggccta      1440
     cctggaaaaa gcttgtgtca tccacagaga cctggcagcc agaaactgtt tggtgggaga      1500
     aaaccaggtc atcaaggtgt ccgactttgg gatgacaaga tttgtccttg atgatcaata      1560
     taccagctcc acgggcacca aattcccagt gaagtgggca tccccagagg tgttctcctt      1620
     tagtcgctat agcagcaagt cagatgtgtg gtcgtttggt gtactgatgt gggaagtctt      1680
     cagtgaaggc aaaatcccat acgaaaaccg aagcaattcc gaggtcgtgg aagatatcag      1740
     cactggcttt cggttataca agccccgcct ggcctcctgt catgtctacc agatcatgaa      1800
     tcattgctgg aaagagaaac cagaagaccg gccacccttc tcccagctgt taagccagct      1860
     ggctgaaatc gcagaagctg ggctttagca gggactcatt gaccagacac agccataaat      1920
     cctgagtgaa ggaacaatgt cctttttcca gagcattaaa agctgccacc agtccagaaa      1980
     cccccacagg tgcctggacc atggtgccag cacctatgca gccacaactg cagcatcata      2040
     gaaaagggtg gagggccagc cactgagcca acagctgaac cacaactgga gcagtatctg      2100
     cgtgtccacc ccatcccagc ctcttgtcgt atgctgtact caaagctcca ttgcccactc      2160
     tcgggagcat cccctccccc tcttagcaat caggagaggc agacgtaggc cacactcttc      2220
     tttattatta cttttaagaa taattcaagt aacctttaat ttggcccaac gagacaatgt      2280
     gcccatttta tggatggaag agcgggaaag catcattctt tttctaagaa atgcaagagg      2340
     tgattaaacc agggtgttct actacttcaa ggctgtcagc cacagcttcc tgc             2393
//