Dbfetch

ID   BC128374; SV 1; linear; mRNA; STD; MUS; 2396 BP.
XX
AC   BC128374;
XX
DT   07-DEC-2006 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus IL2-inducible T-cell kinase, mRNA (cDNA clone MGC:150290
DE   IMAGE:40111687), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2396
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2396
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b12d0f605b40d65a9c1c62cdf1fa954d.
DR   Ensembl-Gn; ENSMUSG00000020395; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018192; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018164; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018129; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018133; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017947; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018587; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017510; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017919; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018029; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018023; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018101; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018047; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018626; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017290; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017560; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020664; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028686; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028652; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028610; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0028432; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0029130; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0028080; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028350; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028487; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028467; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0028596; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028451; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0029161; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027784; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027924; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 28 Row: o Column: 21.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2396
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:150290 IMAGE:40111687"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: CGTCATAA sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..2396
FT                   /gene="Itk"
FT                   /note="synonyms: Emt, Tsk"
FT   CDS             32..1891
FT                   /codon_start=1
FT                   /gene="Itk"
FT                   /product="IL2-inducible T-cell kinase"
FT                   /db_xref="GOA:Q5STT8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR035583"
FT                   /db_xref="MGI:MGI:96621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5STT8"
FT                   /protein_id="AAI28375.1"
FT                   /translation="MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRH
FT                   GKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDCESRQRWVL
FT                   TLKEETRNNNSLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDPSKNASKKPLPPTPED
FT                   NRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAP
FT                   SSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKA
FT                   IISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSW
FT                   RQKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSE
FT                   EDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETL
FT                   LGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGT
FT                   KFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRL
FT                   YKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL"
FT   misc_difference 604
FT                   /gene="Itk"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 838
FT                   /gene="Itk"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2061
FT                   /gene="Itk"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2280
FT                   /gene="Itk"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
XX
SQ   Sequence 2396 BP; 647 A; 615 C; 593 G; 541 T; 0 other;
     cccaaggcgc atcacttttc agaactggac catgaacaac ttcatcctcc tggaagaaca        60
     gctgatcaag aagtcccaac agaagagaag gacttctccc tcgaatttta aagttcgttt       120
     ctttgtctta acgaaagcca gcctggccta ctttgaggac cgccacggga agaagcgcac       180
     gttgaagggc tccattgaac tctccagaat caagtgtgtg gagattgtca agagtgacat       240
     tagcatcccg tgccactata aatacccttt tcaggtcgtg catgacaact atctcctgta       300
     tgtgtttgct ccagactgtg agagtcggca gcgctgggtg ctgaccctta aagaagaaac       360
     gaggaataac aacagcctgg tatccaagta tcaccctaat ttctggatgg atgggcggtg       420
     gaggtgctgc tcccagctgg agaagcctgc tgtaggctgt gctccctacg acccatccaa       480
     gaatgcttca aagaagcctc ttcctcctac tcctgaagac aacaggcggt catttcagga       540
     acctgaagaa accctggtca ttgccttgta cgactaccaa accaacgacc ctcaggagct       600
     cgcgctgcgg tgtgatgaag agtactacct gctggacagc tccgagatcc actggtggag       660
     ggttcaagac aaaaatgggc atgaaggata tgcaccaagc agttacctgg tagaaaaatc       720
     tccaaataac cttgaaacct atgagtggta caataaaagc atcagccgcg acaaagctga       780
     aaaacttctt ttggacacag gtaaagaagg agctttcatg gtccgagatt ccaggacgcc       840
     cgggacatac acagtctctg ttttcaccaa ggccatcata agtgagaacc cctgtataaa       900
     acattatcac atcaaagaaa caaatgacag ccccaagcgc tactacgtgg ctgagaagta       960
     tgtgtttgac tccatccctc tcctcatcca gtatcaccag tacaatggag gaggtttggt      1020
     cactcgactc cgctatccag tttgctcctg gagacaaaaa gcccctgtca cagcagggct      1080
     aagatatggg aagtgggtga tccaaccctc agagctaacg ttcgtgcagg agattggcag      1140
     cgggcagttt gggctggtgc atctcggcta ctggctcaac aaggacaagg tggccatcaa      1200
     gaccattcag gaaggggcga tgtcagaaga agactttatc gaggaggcgg aagtcatgat      1260
     gaaactctct caccccaaac tggtgcagct ctatggggtg tgcctggagc aagcccccat      1320
     ctgcctggtg tttgagttca tggagcacgg ctgcctgtcg gattaccttc gaagtcagcg      1380
     gggtctcttt gctgcggaga ccctgctggg catgtgcctg gatgtgtgtg agggcatggc      1440
     ctacctggaa aaagcttgtg tcatccacag agacctggca gccagaaact gtttggtggg      1500
     agaaaaccag gtcatcaagg tgtccgactt tgggatgaca agatttgtcc ttgatgatca      1560
     atataccagc tccacgggca ccaaattccc agtgaagtgg gcatccccag aggtgttctc      1620
     ctttagtcgc tatagcagca agtcagatgt gtggtcgttt ggtgtactga tgtgggaagt      1680
     cttcagtgaa ggcaaaatcc catacgaaaa ccgaagcaat tccgaggtcg tggaagatat      1740
     cagcactggc tttcggttat acaagccccg cctggcctcc tgtcatgtct accagatcat      1800
     gaatcattgc tggaaagaga aaccagaaga ccggccaccc ttctcccagc tgttaagcca      1860
     gctggctgaa atcgcagaag ctgggcttta gcagggactc attgaccaga cacagccata      1920
     aatcctgagt gaaggaacaa tgtccttttt ccagagcatt aaaagctgcc accagtccag      1980
     aaacccccac aggtgcctgg accatggtgc cagcacctat gcagccacaa ctgcagcatc      2040
     atagaaaagg gtggagggcc agccactgag ccaacagctg aaccacaact ggagcagtat      2100
     ctgcgtgtcc accccatccc agcctcttgt cgtatgctgt actcaaagct ccattgccca      2160
     ctctcgggag catcccctcc ccctcttagc aatcaggaga ggcagacgta ggccacactc      2220
     ttctttatta ttacttttaa gaataattca agtaaccttt aatttggccc aacgagacaa      2280
     tgtgcccatt ttatggatgg aagagcggga aagcatcatt ctttttctaa gaaatgcaag      2340
     aggtgattaa accagggtgt tctactactt caaggctgtc agccacagct tcctgc          2396
//