Dbfetch

ID   BC127619; SV 1; linear; mRNA; STD; MUS; 1558 BP.
XX
AC   BC127619;
XX
DT   12-JAN-2007 (Rel. 90, Created)
DT   21-MAR-2007 (Rel. 91, Last updated, Version 3)
XX
DE   Mus musculus G protein-coupled receptor 37-like 1, mRNA (cDNA clone
DE   MGC:157466 IMAGE:40106370), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1558
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1558
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-NOV-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1876700d73355118050cb92e2ca41a1b.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 10 Row: h Column: 3.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1558
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:157466 IMAGE:40106370"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: CGTCTAA sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1558
FT                   /gene="Gpr37l1"
FT                   /note="synonym: CAG-18"
FT   CDS             201..1247
FT                   /codon_start=1
FT                   /gene="Gpr37l1"
FT                   /product="G protein-coupled receptor 37-like 1"
FT                   /db_xref="GOA:A1L151"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1928503"
FT                   /db_xref="UniProtKB/TrEMBL:A1L151"
FT                   /protein_id="AAI27620.1"
FT                   /translation="MLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFL
FT                   VLFFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLP
FT                   KVRPIERCQSILAKLAVIWVGSMMLAVPELLLWQLAQEPAPTAGTVDSCIMKPSADLPE
FT                   SVYSLVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCES
FT                   QLNSTVVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPV
FT                   LLLCICRPLGQAFLDCCCCCCCEECGGASDSSATVSADSKLKAEVSSSIYFHKPRESPP
FT                   LLPLGTPC"
FT   misc_difference 1558
FT                   /gene="Gpr37l1"
FT                   /note="1 base at the 3' end does not align to the mouse
FT                   genome."
XX
SQ   Sequence 1558 BP; 286 A; 478 C; 419 G; 375 T; 0 other;
     atcccaagcc catccatcct gctggcctgc agcccaccaa gactttggag gccactagcc        60
     ccaacccaga caaggatggg gccaccccag gtaatggaca agagctgagg gtcaacctga       120
     ccgggacgcc aagtcagagg ctgcagattc agaaccccct gtatccggtg accgagagct       180
     cctacagcgc ctacgccatc atgctcctgg ctctggtggt gtttgctgtg ggtatcgttg       240
     gcaatctgtc tgtcatgtgc attgtgtggc acagctacta cttgaagagt gcctggaact       300
     ctatccttgc cagcctggct ctctgggatt tcctggtcct cttcttctgc ctcccaattg       360
     tcatcttcaa tgagattacc aagcaaaggc tactcgggga tgtttcttgc cgggcagtgc       420
     ccttcatgga ggtctcctcc ctgggagtca caaccttcag tctctgtgcc ctgggcatag       480
     accgattcca tgtggccacc agcaccctgc caaaggtgag gcccattgag cgatgtcaat       540
     caattctggc taaactagct gtcatctggg tgggctccat gatgctggcc gtgcccgaac       600
     tcctgctatg gcagctggcc caggagccgg ctcccaccgc aggaactgtg gactcgtgta       660
     tcatgaaacc ttcagctgac ctgcccgaat ctgtctattc gctggtgatg acctaccaga       720
     atgcccgcat gtggtggtat tttggttgct acttctgtct gcccatcctc ttcaccgtca       780
     cctgtcagct ggtgacgtgg cgggtgcggg gcccaccagg caggaagcct gagtgtagag       840
     cgggcaggca tgagcagtgt gagagccagc tcaacagcac cgtggtcggc ctgactgtgg       900
     tctatgcctt ctgtacactc cctgagaacg tctgcaatat cgtggtggct tacctctcta       960
     ccgagctcac gcggcagacc ctggacctcc tgggcctcat caaccagttc tccaccttct      1020
     ttaagggcgc catcacccct gtgctcctcc tgtgcatctg caggccactg ggccaggcct      1080
     ttctggattg ctgctgctgc tgctgctgcg aggagtgcgg cggggcctca gactcctcag      1140
     ccacagtcag cgcggacagc aagctgaagg cggaagtgtc ctcttctatc tacttccaca      1200
     agcccaggga gtcgccccca ctcctgcccc tgggcacccc ttgctgagtc tatgggggat      1260
     cgggagcagg tgcagagccg gcgggggagg ggtgccatcc cggtccatga tggtctgctg      1320
     attctttgac acggtctcac tttgacccct ctctcatctt gctgtttaga gatggacttg      1380
     gctcatcttg tcaaagtctg ggcttttcaa agctccatct acaaacaatg ctgttcttat      1440
     cctccgaggg gcctgccaga tctccacctc cttgtagatg gagatctgtc taggtcatta      1500
     gagttgccca gaatctcaat ctggccaccc tagagccagg gcttggcctt ttgcctaa        1558
//