spacer

EBI Dbfetch

ID   BC127073; SV 1; linear; mRNA; STD; MUS; 3406 BP.
XX
AC   BC127073;
XX
DT   06-NOV-2006 (Rel. 89, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus phosphatidylinositol 3-kinase, catalytic, beta polypeptide,
DE   mRNA (cDNA clone MGC:150132 IMAGE:40110218), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3406
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3406
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 224c18f77079cbfc07cefa0b7a8bf922.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 7 Row: f Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3406
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:150132 IMAGE:40110218"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TGCCTTAT sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..3406
FT                   /gene="Pik3cb"
FT                   /note="synonym: p110beta"
FT   CDS             52..3192
FT                   /codon_start=1
FT                   /gene="Pik3cb"
FT                   /product="Pik3cb protein"
FT                   /db_xref="GOA:A0JNZ1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="UniProtKB/TrEMBL:A0JNZ1"
FT                   /protein_id="AAI27074.1"
FT                   /translation="MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREAT
FT                   ISYIKQMLWKQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLK
FT                   LVTRSCDPAEKLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWI
FT                   DWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAI
FT                   QKRLTIRGKEDEASPCDYVLQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAIN
FT                   RNSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTEETVKVHVRAGLFHGTELL
FT                   CKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPS
FT                   KYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTN
FT                   PYAENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDSANVSSRGGKKFLAVLKEI
FT                   LDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
FT                   LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRF
FT                   LLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNK
FT                   LKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCK
FT                   YMDSKMKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRM
FT                   LPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLD
FT                   RAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRE
FT                   RVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLP
FT                   ELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS"
XX
SQ   Sequence 3406 BP; 942 A; 770 C; 821 G; 873 T; 0 other;
     ggggctgtta ttttgagggc cctgaggtta tgagtgtgct tccgccctat catgcctcct        60
     gctatggcag acaaccttga catctgggca gtggactcac agattgcatc cgatggcgcc       120
     atatccgtcg atttccttct gcccaccggg atttatatcc agttggaagt acctcgggaa       180
     gctaccattt cttatattaa acagatgtta tggaagcaag ttcacaacta cccgatgttt       240
     aacctcctca tggacattga ctcgtatatg tttgcatgtg tgaatcaaac tgctgtatat       300
     gaggaactgg aagacgaaac acgaagactt tgtgatgtca gaccttttct tccagttctc       360
     aaactagtga ctagaagctg tgaccccgca gaaaaattgg actcaaaaat tggagttctt       420
     ataggaaaag gtcttcatga gtttgatgcc ttgaaggatc ccgaagtgaa tgaatttaga       480
     agaaaaatgc gcaaattcag tgaggccaag attcagtctc tggtagggtt gtcttggatc       540
     gactggctaa agcacacgta tccgcctgag cacgagccgt ccgtcctgga gaacttggaa       600
     gataaacttt atggaggaaa gctggttgtg gctgtgcact ttgaaaatag ccaggatgta       660
     tttagttttc aagtgtctcc caatttgaat cctataaaaa taaatgaatt ggcaatccag       720
     aaacgcctca ctattcgtgg aaaggaagat gaagctagcc cctgtgacta tgtgttacag       780
     tacattcgga attgtgtgat gaatagaacc ctgccccact tcatccttgt ggaatgttgt       840
     aagatcaaga aaatgtatga acaagaaatg attgccatag aggctgccat caaccgaaac       900
     tcatccaacc ttcctctccc tttaccacca aagaaaacgc gagttatttc tcatatctgg       960
     gacaacaaca accctttcca aattaccttg gttaaaggaa ataagcttaa tacagaagaa      1020
     actgtgaaag ttcatgtccg agctgggctt tttcacggaa ccgagctcct gtgtaaaacc      1080
     gtcgtaagct cagagatatc aggaaagaac gaccatattt ggaatgaaca actggaattt      1140
     gatattaata tttgtgactt accaagaatg gctcgattat gttttgctgt ttatgcagtt      1200
     ttggataaag taaaaacgaa gaaatcaaca aagactatta atccctctaa gtatcagacc      1260
     atcaggaaag ccgggaaagt gcattatcct gtcgcatggg taaataccat ggtttttgac      1320
     ttcaaaggac agctgaggtc tggagacgtc atattgcata gctggtcttc gtttcctgat      1380
     gagctggaag aaatgctgaa tcccatgggg actgtacaga cgaacccata tgctgagaac      1440
     gccaccgcct tgcacattac gttcccagag aataagaagc agccgtgtta ttatcccccc      1500
     ttcgataaga tcattgagaa ggcagctgag cttgccagcg gagacagtgc taatgtgtca      1560
     agtcgtggtg gaaaaaaatt tcttgctgtg ctgaaagaaa tcttggacag ggaccccctg      1620
     tctcagctgt gtgagaacga aatggacctt atttggactc tacggcaaga ctgccgagaa      1680
     aatttccctc agtcactgcc aaaactactc ttgtcaatca agtggaataa acttgaagat      1740
     gttgctcagc ttcaggcgct cctgcagata tggcccaaac tgccccccag ggaagccctg      1800
     gaactcctgg atttcaacta tccagaccag tatgtccggg aatacgctgt aggctgcctt      1860
     cgacagatga gtgatgaaga actctctcag tatcttttac aattggtgca agttttgaaa      1920
     tatgagcctt ttctcgattg tgccctctcc agattcctat tagaaagagc acttgataat      1980
     cggaggattg ggcagtttct gttttggcat cttaggtcag aggtgcacac tcctgctgtg      2040
     tccgtacagt ttggtgtcat cctggaagca tactgtcgag gaagcgtggg gcacatgaaa      2100
     gtgctttcca aacaggtgga agcactcaat aagttaaaaa ctttaaatag cttaatcaaa      2160
     ctgaatgcgg tgaagctgag cagagctaag ggaaaggagg ccatgcacac gtgcctgaaa      2220
     cagagtgctt accgggaggc gctctctgac ctgcagtcgc cgctgaaccc ctgcgtcatc      2280
     ctctcagagc tctatgttga aaagtgcaaa tacatggact ccaagatgaa gcccctgtgg      2340
     ctggtctaca gcagcagagc ctttggagag gactcggttg gagtgatctt taaaaatggt      2400
     gacgatttgc ggcaggacat gctgacgctg cagatgctgc gcctgatgga tctgctttgg      2460
     aaagaagctg gcttggacct gcggatgctc ccctatggct gcttagcaac aggagatcgc      2520
     tctggcctca ttgaggttgt gagcacctct gagacaatcg ctgacattca gctgaacagt      2580
     agtaacgtgg ctgccacggc agccttcaac aaagacgcac tcctgaactg gctcaaggag      2640
     tacaactctg gggatgacct ggaccgagcg attgaggagt ttaccttgtc ctgtgctggc      2700
     tactgtgtag cctcttatgt cctcggcatt ggtgacaggc acagtgacaa catcatggtg      2760
     aagaaaaccg gccagctctt ccacatagat tttgggcata ttcttggaaa tttcaaatct      2820
     aaatttggca ttaaaaggga gcgagtacct tttattctta cttatgactt cattcatgtc      2880
     attcaacaag gaaaaacggg aaacactgaa aaatttggca gattccgcca gtgctgtgaa      2940
     gatgcgtatc tgattttacg gcggcatggg aatctcttca tcaccctgtt tgccctgatg      3000
     ttgactgcag ggctgcctga gctcacatcg gtcaaagata tacagtatct taaggactcg      3060
     cttgccttag ggaagagcga ggaggaagca ctgaagcagt tcaagcagaa gtttgacgag      3120
     gccctcaggg aaagctggac tactaaagtg aactggatgg ctcacacagt acggaaagac      3180
     tacaggtcct agcgtccgcc ctactctgcc gcacttgcct gttcgtttcc tttccatttt      3240
     gcacttgcac tattgaacat gaccctgcca gaaatgcaaa gggaatgaaa tcctgaagct      3300
     cagagtgaag ttcaaaccac ggcgtcccgc agagcctagt ctgaaccacc ccatgcccac      3360
     cctgtgttcc cgagcgcttc caggactcat cgtgagcagc agcatg                     3406
//


spacer
spacer