spacer

EBI Dbfetch

ID   BC125430; SV 1; linear; mRNA; STD; MUS; 1649 BP.
XX
AC   BC125430;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus tryptophan hydroxylase 2, mRNA (cDNA clone MGC:159133
DE   IMAGE:40129945), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1649
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1649
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8034f8148982a18d94eb1d19bb19cd90.
DR   Ensembl-Gn; ENSMUSG00000006764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006949; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 4 Row: G Column: 10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1649
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:159133 IMAGE:40129945"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: AACTCGCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1649
FT                   /gene="Tph2"
FT                   /note="synonym: Ntph"
FT   CDS             125..1591
FT                   /codon_start=1
FT                   /gene="Tph2"
FT                   /product="tryptophan hydroxylase 2"
FT                   /db_xref="GOA:Q8CGV2"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005963"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019773"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="MGI:MGI:2651811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGV2"
FT                   /protein_id="AAI25431.1"
FT                   /translation="MQPAMMMFSSKYWARRGLSLDSAVPEDHQLLGSLTQNKAIKSEDK
FT                   KSGKEPGKGDTTESSKTAVVFSLKNEVGGLVKALRLFQEKHVNMLHIESRRSRRRSSEV
FT                   EIFVDCECGKTEFNELIQLLKFQTTIVTLNPPESIWTEEEDLEDVPWFPRKISELDRCS
FT                   HRVLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVF
FT                   RELSKLYPTHACREYLKNLPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLS
FT                   PRDFLAGLAYRVFHCTQYVRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLA
FT                   SLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKSFD
FT                   PKTTCLQECLITTFQDAYFVSDSFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDT
FT                   RSIENVVQDLRSDLNTVCDALNKMNQYLGI"
XX
SQ   Sequence 1649 BP; 439 A; 411 C; 430 G; 369 T; 0 other;
     tcagcaccag ggttctggac agcgccccga gcaggcagct gccactgcag ttcctccttc        60
     atctctgcca aggccgcccc tctggtcccc cctgctgctg agaaagaaaa ttacatcggg       120
     agccatgcag cccgcaatga tgatgttttc cagtaaatac tgggccagga gagggttgtc       180
     cttggattct gctgtgccag aagatcatca gctacttggc agcttaacac aaaataaggc       240
     tatcaaaagc gaggacaaga aaagcggcaa agagcccggc aaaggcgaca ccacagagag       300
     cagcaagaca gcggtagtgt tctccttgaa gaatgaagtt ggtgggctgg tgaaagcact       360
     tagactattc caggaaaaac atgtcaacat gcttcatatc gaatccagga ggtcccgacg       420
     aagaagttct gaagtcgaaa tcttcgtgga ctgcgaatgt ggcaaaacgg aattcaatga       480
     gctcatccag ttgctgaaat ttcagaccac cattgtgacc ctgaatccgc ctgagagcat       540
     ttggacggag gaagaagatc tcgaggatgt gccgtggttc cctcggaaga tctctgagtt       600
     agacagatgc tctcaccgag tcctcatgta cggcaccgag cttgatgccg accatccagg       660
     atttaaggac aatgtctatc gacagaggag gaagtatttt gtggatgtgg ccatgggcta       720
     taaatatggt cagcccattc ccagggtcga gtacacagaa gaagagacta aaacttgggg       780
     tgttgtgttc cgggagctct ccaaactcta cccgactcat gcttgccggg agtacctgaa       840
     aaacctcccc ctgctgacca agtactgtgg ctacagggaa gacaacgtgc cgcaactgga       900
     agacgtctcc atgtttctga aagagcgatc tggcttcaca gtgagaccag tggctggcta       960
     cctgagccca agagacttcc tggcgggcct ggcctacaga gtattccact gcacccagta      1020
     cgtgcggcat ggctccgacc ccctctacac cccggaacca gatacatgcc atgaactctt      1080
     gggacacgtg ccactgcttg cggatcccaa gtttgctcag ttttcccaag agataggctt      1140
     agcgtctctg ggagcctcag atgaggacgt tcagaaacta gccacgtgct atttcttcac      1200
     aatcgagttc ggcctttgca agcaagaggg tcaactgcgg gcgtatggag cagggttact      1260
     ttcgtccatc ggagaattga agcatgctct ttccgacaag gcgtgtgtga aatcctttga      1320
     cccaaagacg acctgcttgc aggaatgcct aatcaccacc tttcaggacg cttactttgt      1380
     ttcggacagt tttgaagaag ccaaagaaaa gatgagggac tttgcaaagt caattacccg      1440
     tcccttctcg gtatacttca acccctacac gcagagcatt gaaattctga aagacaccag      1500
     aagtattgag aatgtggtgc aggacctgcg cagtgatttg aacacagtgt gtgatgcctt      1560
     gaataaaatg aaccaatatc tggggatttg atgcctagaa ccagagttat tgtcagcatg      1620
     agctcttggg ggggtgtagc aacaatgca                                        1649
//


spacer
spacer