spacer

EBI Dbfetch

ID   BC125414; SV 1; linear; mRNA; STD; MUS; 2421 BP.
XX
AC   BC125414;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus interleukin 21, mRNA (cDNA clone MGC:159117 IMAGE:40129929),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2421
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2421
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; eb7037f8af7427cbcfe89f929fcc1fca.
DR   Ensembl-Gn; ENSMUSG00000027718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029273; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 4 Row: F Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2421
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:159117 IMAGE:40129929"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCCTCCCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2421
FT                   /gene="Il21"
FT   CDS             42..482
FT                   /codon_start=1
FT                   /gene="Il21"
FT                   /product="Il21 protein"
FT                   /db_xref="GOA:Q5SUE2"
FT                   /db_xref="InterPro:IPR003443"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR028151"
FT                   /db_xref="MGI:MGI:1890474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUE2"
FT                   /protein_id="AAI25415.1"
FT                   /translation="MERTLVCLVVIFLGTVAHKSSPQGPDRLLIRLRHLIDIVEQLKIY
FT                   ENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARR
FT                   GGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS"
XX
SQ   Sequence 2421 BP; 727 A; 505 C; 499 G; 690 T; 0 other;
     aaggccctgt catcagctcc tggagactca gttctggtgg catggagagg acccttgtct        60
     gtctggtagt catcttcttg gggacagtgg cccataaatc aagcccccaa gggccagatc       120
     gcctcctgat tagacttcgt caccttattg acattgttga acagctgaaa atctatgaaa       180
     atgacttgga tcctgaactt ctatcagctc cacaagatgt aaaggggcac tgtgagcatg       240
     cagcttttgc ctgttttcag aaggccaaac tcaagccatc aaaccctgga aacaataaga       300
     cattcatcat cgacctcgtg gcccagctga ggaggaggct gcctgccagg aggggaggaa       360
     agaaacagaa gcacatagct aaatgccctt cctgtgattc gtatgagaaa agaacaccca       420
     aagaattcct agaaagacta aaatggctcc ttcaaaagat gattcatcag catctctcct       480
     agaacacata ggacccgaag attcctgagg atctgagaag attcccgagg accgaggaga       540
     cgccggacac tatagacgct cacgaatgca ggagtacatc ttgtctcttg ggattgcgag       600
     tggagaagta cgatatgtta tgataagaac aactcagaaa agctataggt taagatcctt       660
     tcacccatta actaagcaga cattgtggtt ccctgcacag actccatgct gtcaacatgg       720
     aaaatctcaa ctcaacaaga gcccagcttc ccgtgtcagg gatttctggt gcttctcaag       780
     ctgtggcttc atcttattgc ccaactgtga cattctttga ttggaagggg aaaactaaag       840
     cttttagcaa aaatacagct agggaatttg tcgatctgca agagtaagac ctcttatgat       900
     cctaacggaa tgatgtaagc tggaaataat aagcataaga tgaaattgaa aattgaagtc       960
     tttattcttt aagaaaaact ttgtacttga aagcatgtct gaagagttta ctcattacca      1020
     caaacatcta gcatattgat aactaacgtc tttatactct acaagagagg ctttccagat      1080
     gggtacagtt tttcttctct attaggtcta tcaaaattta acctattatg agggtcaccc      1140
     ctggctttca ctgtttttct aaagaggcaa gggtgtagta agaagcaggc ttaagttgcc      1200
     ttcctcccaa tgtcaagttc ctttataagc taatagttta atcttgtgaa gatggcaatg      1260
     aaagcctgtg gaagtgcaaa cctcaccatc ttctggagcc aagtagaatt ttcaagtttg      1320
     tagctctcac ctcaagtggt tatgggtgtc ctgtgatgaa tctgctagct ccagcctcag      1380
     tctcctctcc cacatccttt cctttctttc ctctttgaaa cttctaagaa aaagcaattc      1440
     aaacaagttc agcacttaag acacattgca tgcacactct tgataagtta aatccaacca      1500
     tctatttaaa atcaaaatca ggagatgagc caagagacca gaggttctgt tccagtttta      1560
     aacagacttt tactgaacat cccaatcttt taaccacaga ggctaaattg agcaaatagt      1620
     tttgccattt gatataattt ccaacagtat gtttcaatgt caagttaaaa agtctacaaa      1680
     gctattttcc ctggagtggt atcatcgctt tgagaatttc ttatggttaa aatggatctg      1740
     agatccaagc atggcctggg ggatggtttt gatctaagga aaaaggtatc tgtacctcac      1800
     agtgccttta aaacaagcag agaccccgtg taccgcacag actagtgtta actgattccc      1860
     agaaaagtgt cacaatcaga gccaacgcat tctcttaaac tttaaaaata tgtattgcaa      1920
     agaacttgtg taactgtaaa tgtgtgactg ttgatgacat tatacacaca tagcccacgt      1980
     aagtgtccaa tggtgctagc attggttgct gagtttgctg ctcgaaagct gaagcagaga      2040
     tgcagtcctt cacaaagcaa tgatggacag agaggggagt ctccatgttt tattcttttg      2100
     ttgtttctgg ctgtgtaact gttgacttct tgacattgtg atttttatat ttaagacaat      2160
     gtatttattt tggtgtgttt attgttctag ccttttaaat cactgacaat ttctaatcaa      2220
     gaagtacaaa taattcaatg cagcacaggc taagagcttg tatcgtttgg aaaagccagt      2280
     aaaggcttct ccactagcca tgggaaagct acgctttaga gtaaactaga caaaattgca      2340
     cagcagtctt gaacctctct gtgctcaaga ctcagccagt cctttgacat tattgttcac      2400
     tgtgggtggg aacacattgg a                                                2421
//


spacer
spacer