Dbfetch

ID   BC120684; SV 1; linear; mRNA; STD; MUS; 1153 BP.
XX
AC   BC120684;
XX
DT   08-AUG-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus bradykinin receptor, beta 1, mRNA (cDNA clone MGC:155921
DE   IMAGE:40129607), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1153
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1153
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ceb8b531fd81e9095a14f77ca0ae3a4a.
DR   Ensembl-Gn; ENSMUSG00000041347; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020092; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020046; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020022; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020032; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019834; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020477; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019376; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019801; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019918; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019903; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019993; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019941; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020506; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019135; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019433; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000041229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182899; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035872; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0035790; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0035770; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035796; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035564; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036280; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035502; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0035481; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0035621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0035599; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0035760; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036316; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035171; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035011; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 3 Row: I Column: 8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1153
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:155921 IMAGE:40129607"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ATTGGAGA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1153
FT                   /gene="Bdkrb1"
FT                   /note="synonyms: Bdkrb, B1R, BKR1, B1BKR, BRADYB1"
FT   CDS             49..1053
FT                   /codon_start=1
FT                   /gene="Bdkrb1"
FT                   /product="bradykinin receptor, beta 1"
FT                   /db_xref="GOA:Q0VBD7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000496"
FT                   /db_xref="InterPro:IPR001186"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:88144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBD7"
FT                   /protein_id="AAI20685.1"
FT                   /translation="MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVIT
FT                   VCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENV
FT                   GNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQV
FT                   TCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPL
FT                   AAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDF
FT                   LVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL"
XX
SQ   Sequence 1153 BP; 210 A; 339 C; 308 G; 296 T; 0 other;
     agctgggctt ggcctcctat actctctgtc aatttcaggt tcctgtggat ggcgtcccag        60
     gcctcgctga agctacagcc ttctaaccaa agccagcagg cccctcccaa catcacctcc       120
     tgcgagggcg ccccggaagc ctgggatctg ctgtgtcggg tgctgccagg gtttgtcatc       180
     actgtctgtt tctttggcct cctggggaac cttttagtcc tgtccttctt ccttttgcct       240
     tggcgacgat ggtggcagca gcggcggcag cgcctaacca tagcagaaat ctacctggct       300
     aacttggcag cttctgatct ggtgtttgtg ctgggcctgc ccttctgggc agagaacgtt       360
     gggaaccgtt tcaactggcc ctttggaagt gacctctgcc gggtggtcag cggggtcatc       420
     aaggccaacc tgttcatcag catcttcctg gtggtggcca tcagtcagga ccgctacagg       480
     ttgctggtat accccatgac cagctggggg aaccggcggc gacggcaagc ccaagtgacc       540
     tgcctgctca tctgggtagc tgggggcctc ttgagcaccc ccacgttcct tctgcgttcc       600
     gtcaaagtcg tccctgatct gaacatctct gcctgcatcc tgcttttccc ccacgaagct       660
     tggcactttg taaggatggt ggagttgaac gttttgggtt tcctcctccc attggctgcc       720
     atcctctact tcaactttca catcctggcc tccctgagag gacagaagga ggccagcaga       780
     acccggtgtg ggggacccaa ggacagcaag acaatggggc tgatcctcac actggtagcc       840
     tccttcctgg tctgctgggc cccttaccac ttctttgcct tcctggattt cctggtccag       900
     gtgagagtga tccaggactg cttctggaag gagctcacag acctgggcct gcagctggcc       960
     aacttctttg cttttgtcaa cagctgcctg aacccactga tttatgtctt tgcaggccgg      1020
     ctctttaaga ccagggttct gggaacttta taagtgatgc acctctttat aaaatgccgg      1080
     tattgcccag taggaaagaa ctcttccaac tgtcctgctg gaattgaaac agcattgagc      1140
     caagaagcct ggc                                                         1153
//