spacer

EBI Dbfetch

ID   BC120526; SV 1; linear; mRNA; STD; MUS; 1549 BP.
XX
AC   BC120526;
XX
DT   08-AUG-2006 (Rel. 88, Created)
DT   08-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus G protein-coupled receptor 151, mRNA (cDNA clone MGC:155763
DE   IMAGE:40129449), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1549
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1549
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e746af7fc410a95a60e2ec7f0c011e15.
DR   Ensembl-Gn; ENSMUSG00000042816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054738; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 3 Row: B Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1549
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:155763 IMAGE:40129449"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACGGCATC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1549
FT                   /gene="Gpr151"
FT                   /note="synonyms: nGPCR-2037, GPCR, PGR7, GalRL"
FT   CDS             22..1290
FT                   /codon_start=1
FT                   /gene="Gpr151"
FT                   /product="G protein-coupled receptor 151"
FT                   /db_xref="GOA:Q7TSN6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TSN6"
FT                   /protein_id="AAI20527.1"
FT                   /translation="MGKAMLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPS
FT                   LLMAVCLVGLVGNLCVIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYS
FT                   KGVWDLGWFICKSSDWFTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLA
FT                   GIWVVASLLPLPEWLFSTTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLA
FT                   GVYFWRAYDQCKTRCTKTRNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVK
FT                   AGGPMPPQGFIALSQVLMFFTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQ
FT                   EAPAGNTEALPGKAPSPETQTCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDA
FT                   VPSAQDNDPIPWEHEGQETEGCN"
XX
SQ   Sequence 1549 BP; 379 A; 390 C; 394 G; 386 T; 0 other;
     ccatctgcag ggaggagctt gatgggaaag gcaatgctga gagctgggtt tgccgacacc        60
     aattccagca acatgaacga gtcgtttgct cgcctccact ttgcaggagg ctacctgccg       120
     tctgactcca aggactggag gaccatcatt ccgtctctct tgatggccgt gtgcctggtg       180
     ggtctcgtgg gaaacctgtg tgtgattggc attctccttc atggcgtttg gaaaagaaag       240
     ccatccacga tccactccct gattctgaat ctaagcctgg ctgacttctc tctcctgctc       300
     ttctctgcac ctgtccgagc ggcagcatac tccaagggcg tttgggatct cggctggttc       360
     atctgcaagt cctctgactg gttcacccac gtgtgcatgg cagccaagag cttgacattt       420
     gttgtggtag ccaaagcatg cttcgcgtat gcaagtgacc cagccaagca agagagtatc       480
     cacagccgca ccatctggtc agtgctggcg ggcatctggg ttgtagccag cctgcttccc       540
     ctgccagaat ggctctttag caccaccaga cgtcacgcag gtgtggaaat gtgcctcgtg       600
     gatgtgccag ctgtggcaga agaattcatg tccatgttcg gtaagctcta ccctctgctg       660
     gtgttctgcc ttcctttact tctggctggc gtttatttct ggcgagctta tgaccaatgt       720
     aagacacgat gtacgaaaac tcgaaatctg agagaccaga tgcgttcaaa gcaactcaca       780
     gtgatgctgc taagcactgc aatcatctct gctcttctgt ggctcccaga gtggatagcc       840
     tggctgtggg tatggcatgt gaaggctgga gggccgatgc caccacaggg gttcatagcc       900
     ctgtctcaag ttctcatgtt tttcacctcc acagcaaacc ctctcatttt tctagttatg       960
     tctgaagagt tcaaggcagg cttgaaaggc ctatggaaat ggatgataac cagaaagcca      1020
     gcagttactt cagaggttca ggaggcacct gctggaaaca cagaggccct tcccggaaag      1080
     gctccatcac cagagaccca aacatgcatc ctagacacag acggacgtgg gtctcctgat      1140
     gacagcaaag agaaatctgg taaggtggtg gctcccatcc tccctgacgt ggagcagttt      1200
     tggcacgaga gggatgctgt cccttcagca caagacaatg accctatacc ctgggaacac      1260
     gaaggccaag agacagaggg ctgcaattaa cagacttgag tttcaaagaa aagcaaattg      1320
     tcgttactgt gtttacttgt accactgctt agcaatattg gtgaagtaaa ttgccattag      1380
     aaattgcaaa gatttctgct ttcaaactat agaacctggt aagtagaaag gcatgtagca      1440
     attaggcttc agaactaaag tccgtctaaa gaaatcaatt gaagtgctat gtaaagaaaa      1500
     ctttcagtga ttatagggct cacgctggct ttcccccagg gtatccctt                  1549
//


spacer
spacer