spacer

EBI Dbfetch

ID   BC120507; SV 1; linear; mRNA; STD; MUS; 1821 BP.
XX
AC   BC120507;
XX
DT   08-AUG-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 1F, mRNA (cDNA clone
DE   MGC:155744 IMAGE:40129430), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1821
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1821
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a6a3fe6185c2ebb4384f4296bc3bcc05.
DR   Ensembl-Gn; ENSMUSG00000050783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063076; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 3 Row: A Column: 23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1821
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:155744 IMAGE:40129430"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTACAACT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1821
FT                   /gene="Htr1f"
FT   CDS             167..1267
FT                   /codon_start=1
FT                   /gene="Htr1f"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1F"
FT                   /db_xref="GOA:Q543V2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000450"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99842"
FT                   /db_xref="UniProtKB/TrEMBL:Q543V2"
FT                   /protein_id="AAI20508.1"
FT                   /translation="MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVI
FT                   AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDI
FT                   ICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRH
FT                   QGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIK
FT                   EELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQ
FT                   KISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNS
FT                   LINPLIYTIFNEDFKKAFQKLVRCRY"
XX
SQ   Sequence 1821 BP; 562 A; 360 C; 363 G; 536 T; 0 other;
     ccttagcttc gctctgggga agctgagttg agatggcatt gaactgtgaa tggctgacta        60
     atttctcacc agatcaggag gtgaagtgag aatgaagacc aacagttgag cctgccacac       120
     cacggtattc atttcttcaa ctatattaac attttaacaa aaaaaaatgg attttttaaa       180
     cgcatcagac caaaacttga cctctgagga actgttaaac cgaatgccat ccaaaattct       240
     ggtatccctc actctgtctg ggctggcatt gatgacaacc accatcaact ccctcgtgat       300
     cgctgcgatc attgtgactc ggaagctgca ccacccagcc aactatttaa tttgttcctt       360
     ggcagttaca gattttcttg tagctgtcct ggtgatgccc ttcagtattg tgtacattgt       420
     gagagagagc tggattatgg gacaagtact ctgtgacatt tggctgagtg tcgacatcat       480
     ctgttgtacg tgttccatct tgcatctgtc ggctatagcc ttggataggt accgcgccat       540
     cacagatgca gttgaatacg ccaggaagag gactcccagg catgccggca tcatgatcac       600
     gatcgtgtgg gttatatctg tgttcatctc tatgcctcct ctcttctgga ggcaccaagg       660
     aactagccgt gatgatgagt gtgtcatcaa acatgaccac attgtttcca caatttactc       720
     cacgtttgga gctttctaca tcccgcttgt attgatattg atcctctact acaaaatata       780
     cagagcagca aggacactgt accacaagag acaagcgagt cggatgataa aggaggagct       840
     gaacggtcaa gtcttcttgg agagcggtga gaagagcatt aaactggtct ccacatccta       900
     catgttagaa aaatccttgt ccgatccatc aacggacttt gatagaattc acagcaccgt       960
     gaaaagtccc agatcggaac tgaagcatga gaaatcttgg agaagacaga aaatctcagg      1020
     caccagagaa cgcaaagcag ccactaccct gggattgatc ttgggtgcat ttgtaatatg      1080
     ttggctgccc ttttttgtaa aagaattggt tgttaatgtc tgtgaaaaat gtaaaatttc      1140
     tgaagaaatg tcaaactttt tggcatggct tggttacctg aattccctta taaatccact      1200
     gatttatacc atctttaatg aagacttcaa gaaagctttc caaaaacttg tacgatgccg      1260
     atattaggat aaaagaaacc taattttaaa gtgcggaggc tttatttgtt ggggggaggg      1320
     gcagggataa ttaaatgaat gtaaagtaag aaaacattta aatttttaga gaaaatatat      1380
     taaaactgct aaaattataa gaggataaat ttatttttaa tagcaccaag aaaataagat      1440
     gtattcattt ggccataatt ttaatgttct caagattagg aaataattta tgcagctcag      1500
     ctcgtaatat tttgtctatg caatatacct aagaagctaa ctagaaatac atatatataa      1560
     taattgataa tatatgcata tatattatca attacaatgc tttccaggtt tatatgttac      1620
     aacaactaga gacattttta actagcatct ttccactggt aatttctgtc acctcattgc      1680
     ttaaccacta tttatagaaa aatattcaat gtaatgctac tattgcccct tctccatctt      1740
     ctccactaca aaggtggaga tatagcaaca gcagctccta tttagcctta gcagagaaga      1800
     tatgaagctc agcggctttg a                                                1821
//


spacer
spacer