spacer

EBI Dbfetch

ID   BC119272; SV 1; linear; mRNA; STD; MUS; 2239 BP.
XX
AC   BC119272;
XX
DT   10-AUG-2006 (Rel. 88, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus calcitonin receptor, mRNA (cDNA clone MGC:155588
DE   IMAGE:8734021), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2239
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2239
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8e4cde30ac1be958d62e0f4ebcc9e499.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170266; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 2 Row: K Column: 11.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2239
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:155588 IMAGE:8734021"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CGTCGACG"
FT                   /db_xref="taxon:10090"
FT   gene            1..2239
FT                   /gene="Calcr"
FT                   /note="synonym: Clr"
FT   CDS             62..1663
FT                   /codon_start=1
FT                   /gene="Calcr"
FT                   /product="calcitonin receptor"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="AAI19273.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLSAHEGKMDPHASEVISCKVLHFLHQ
FT                   YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYN
FT                   DNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKAT
FT                   MVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKR
FT                   QWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEE
FT                   STEMIPMNVIQQDASA"
FT   misc_difference 2237
FT                   /gene="Calcr"
FT                   /note="1 base in cDNA is not found in the mouse genome."
XX
SQ   Sequence 2239 BP; 552 A; 565 C; 514 G; 608 T; 0 other;
     agagcgcctt ccagaggaga agaaaccgag ggagcagggc tactacacag aggatttgaa        60
     aatgactcca aggaggtcca gagtgaaaag gcggaatctc cgcaaaccga agatgaggtt       120
     ccttctcgtg aacaggttca ccctgctgct cctgctccta gtgagcccaa ctccagttct       180
     tcaggctcct accaatctca ctgactccgg ccttgatcag gagccattcc tgtacttggt       240
     tggccgcaag aagctgctgg atgctcagta caaatgctat gaccggattc atcagttgcc       300
     ctcttatgaa ggagaaggtc tgtactgcaa ccgcacctgg gatggctgga tgtgctggga       360
     cgacactccc gctggagcca cagcctatca gcactgccct gactacttcc cggactttga       420
     cacagcagaa aaggtttcaa aatactgtga tgaaaatgga gagtggttta gacaccctga       480
     cagcaaccga acctggtcca actatactct gtgcaacgct ttcacttctg agaaactgca       540
     aaatgcgtac gttctttatt acctggctct tgtgggtcac tccttgtcga ttgctgcttt       600
     ggttgcttcc atgctgatct tctggatttt caagaacctt agctgccaga gggtgacctt       660
     gcacaagcac atgttcctta cttatattct gaattctatc attatcatca tccacctggt       720
     tgaggttgtg cccaatggag atctggtgcg gcgggatcct atgcatattt ttcatcataa       780
     cacacatatg tggacaatgc agtgggaact gtcaccaccc ttacccctga gtgcacacga       840
     gggaaagatg gaccctcatg ccagtgaagt gataagttgc aaggttctac actttttaca       900
     tcagtacatg atgtcttgca actacttctg gatgctctgc gaggggatct atcttcatac       960
     tctgattgtc atggctgtgt ttaccgacga gcaacgccta cgctggtact atcttcttgg      1020
     ctgggggttc ccgatagtgc caaccattat ccacgccatc actcgtgccc tctactacaa      1080
     cgacaactgc tggctgagtg cagaaaccca cttgctttac atcatccatg gacccgtcat      1140
     ggtggctctg gtggtcaact tcttctttct tctcaacatt gtccgcgtgc ttgtgaccaa      1200
     gatgaggcaa acccacgagg ccgagtccta catgtacctg aaggctgtga aggccaccat      1260
     ggtccttgtg cccctgctgg ggatccagtt tgttgtgttt ccctggaggc cctccaacaa      1320
     ggtgcttggg aagatctatg attatctcat gcactctctg attcatttcc agggattctt      1380
     tgtggcgact atctactgct tctgcaacca tgaggtgcaa gtcaccctga agcgccagtg      1440
     gacgcagttc aagatccagt ggagccaacg ctggggaagg cgccgccgcc ccaccaaccg      1500
     cgtagttagt gctcctcggg ctgtagcctt cgctgagcca gatggcctcc ccatttacat      1560
     ctgccatcag gaaccacgga atcctccaat cagcaacaac gaaggcgagg agagtactga      1620
     aatgatcccc atgaacgtca tccagcaaga cgcatccgct tgaatgtgaa gccaccccaa      1680
     gcattgtgat ccactgagcc ttcatttcct ggggaaagac agaccatgtg tttcaagtga      1740
     ttcccatcct cccaggagct gaccatatca tttgtgaaga agtgttaagt gaatttgtcc      1800
     atagtgaatt tgaagaaagt gattcttggt actattgctt tgggagtcag tctaggaata      1860
     gagtctccca ttgcaacttg tgaactccat cattcatcct ggactgagat gactgtgttc      1920
     gtaggaaagc aggcaaggtg ttcaaaagat gtcacactat tgacctagtt cagatacagg      1980
     gtgctccttg tgaattttga gccatttgta ccgttgagaa attaaaatca ctctcaatgt      2040
     ttttaaattt gacactggat tttgaattag actatttctg tatttgacta cagatctggt      2100
     ttttaatgtt tttatttcag tcagttccta tattacacat gttaccatcc atacaatgtc      2160
     aactacacat atagcatgac ctctgaaaga tggtgtgtct tttataacat gatccagttc      2220
     accaggcaga cccaaagtg                                                   2239
//


spacer
spacer