Dbfetch

ID   BC119181; SV 1; linear; mRNA; STD; MUS; 996 BP.
XX
AC   BC119181;
XX
DT   10-AUG-2006 (Rel. 88, Created)
DT   10-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus N-acetyltransferase 1 (arylamine N-acetyltransferase), mRNA
DE   (cDNA clone MGC:155497 IMAGE:8733930), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-996
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-996
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 50f546f6737c0b42186bdfe1bcd63af4.
DR   Ensembl-Gn; ENSMUSG00000025588; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033656; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033638; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033563; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033634; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033344; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034151; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032669; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033322; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033476; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033417; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033564; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033461; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034169; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032378; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032786; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026677; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089007; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0089094; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0089022; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089034; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0088596; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089556; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089146; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0088547; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088740; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0088578; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088766; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0088616; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089848; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088564; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0087640; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 2 Row: G Column: 16.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..996
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:155497 IMAGE:8733930"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTATTCTC"
FT                   /db_xref="taxon:10090"
FT   gene            1..996
FT                   /gene="Nat1"
FT   CDS             22..894
FT                   /codon_start=1
FT                   /gene="Nat1"
FT                   /product="N-acetyltransferase 1 (arylamine
FT                   N-acetyltransferase)"
FT                   /db_xref="GOA:Q546L3"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:97279"
FT                   /db_xref="UniProtKB/TrEMBL:Q546L3"
FT                   /protein_id="AAI19182.1"
FT                   /translation="MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCG
FT                   EAMHLDLQDIFDHIVRKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSE
FT                   MVHLLVQVTISDRKYIVDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQ
FT                   IRREQYVPNEEFVNSDLLEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSF
FT                   CSLQTSEGVHCLVGSTFTSRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVP
FT                   KHGELVFTI"
XX
SQ   Sequence 996 BP; 297 A; 191 C; 227 G; 281 T; 0 other;
     ttctgtttgc cttaggggac catggacatc gaagcatact ttgaaaggat tggttacaag        60
     aactcagtga ataaattgga cttagccaca ttaactgaag ttcttcagca ccagatgcga       120
     gcagttcctt ttgagaatct taacatgcat tgtggagaag ccatgcatct ggatttacag       180
     gacatttttg accacatagt aaggaagaag agaggtggat ggtgtctcca ggttaatcat       240
     ctgctgtact gggctctgac caaaatgggc tttgaaacca caatgttggg aggatatgtt       300
     tacataactc cagtcagcaa atatagcagt gaaatggtcc accttctagt acaggtgacc       360
     atcagtgaca ggaagtacat tgtggattcc gcctatggag gctcctacca gatgtgggag       420
     cctctggaat taacatctgg gaaggatcag cctcaggtgc ctgccatctt ccttttgaca       480
     gaggagaatg gaacctggta cttggaccaa atcagaagag agcagtatgt tccaaatgaa       540
     gaatttgtta actcagacct ccttgaaaag aacaaatatc gaaaaatcta ctcctttact       600
     cttgagcccc gagttatcga ggattttgaa tatgtgaata gctatcttca gacatcgcca       660
     gcatctgtgt ttgtaagcac atcgttctgt tccttgcaga cctcggaagg ggttcactgt       720
     ttagtgggct ccacctttac aagtaggaga ttcagctata aggacgatgt agatctggtt       780
     gagtttaaat atgtgaatga ggaagaaata gaagatgtac tgaaaaccgc atttggcatt       840
     tctttggaga gaaagtttgt gcccaaacat ggtgaactag tttttactat ttagggtaag       900
     gagcaaaatt gttctccatt gttatttcat agtcttaaac cttctaaaca tatgcaaatg       960
     tatccataac agaaatcacc cagtccaatg ctgacc                                 996
//