Dbfetch

ID   BC119074; SV 1; linear; mRNA; STD; MUS; 1957 BP.
XX
AC   BC119074;
XX
DT   10-AUG-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-A) receptor, subunit theta, mRNA
DE   (cDNA clone MGC:155390 IMAGE:8733823), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1957
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1957
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 49cd51e1b9b8c3105307efc90816ede5.
DR   Ensembl-Gn; ENSMUSG00000031344; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035794; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035778; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035700; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035765; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035468; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036295; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034760; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035443; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035596; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035547; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035685; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035582; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036316; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034460; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034902; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033711; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096330; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096423; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096360; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096347; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095897; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096852; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096488; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095814; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0096022; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095865; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095830; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097200; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095905; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094874; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 2 Row: C Column: 5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1957
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:155390 IMAGE:8733823"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TCCGCTTC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1957
FT                   /gene="Gabrq"
FT   CDS             19..1935
FT                   /codon_start=1
FT                   /gene="Gabrq"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit theta"
FT                   /db_xref="GOA:Q0VEX8"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008101"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:1888498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEX8"
FT                   /protein_id="AAI19075.1"
FT                   /translation="MGIRGMLRAAALLLLIRTWLAESNGPSPTPKFHFELSSSTPEVIL
FT                   DLFNCKNCANEAVVQKILDRVLSTYDVRLRPNFGGAPVPVSVSIYVSSIEQISEINMDY
FT                   TITMFLHQTWKDTRLAYYETNLNLTLDYRMHEKLWVPDCYFVNSKDAFVHDVTVENRVF
FT                   QLHPDGTVRYGIRLTTTAACSLDLQKFPMDKQSCKLEVESYGYTVEDIVLSWEDDNAIH
FT                   ITDGLHIPQYTYLGRTITSKEVYFYTGSYMRLIVKFQVQREVRSYLVQVYWPTVLTTIL
FT                   SWISFWMNYDSSAARVTIGLTSILVLTTIDSHMRDKLPHISCIKAIDIYILVCLFFVFL
FT                   SLLEYVYINYLFFSQVPRRNHRRCRKPRRVVARYRYQEVVVANVQDGLINVEDRVEDRA
FT                   GPLPDSPMQAHLASQESLGSLVFTSEQAQLATSESLSLLSSASSQTQLATGESLSDLPS
FT                   TSEQTVPECTIHFHGFLTNDSIIPIKIHSRSDACDDEDSEESLSSEESHGHGSSHTGRL
FT                   KLQISQRCVQEASWDLDKIEILQDDISITSSWLGLDEQCKGDADSIWSLTDEELMACDQ
FT                   EKDSSSESEENCSPSPGCSFNEGFSFQLFKPNRVPKVDRWSRFLFPLSFGLFNVVYWLY
FT                   HVY"
XX
SQ   Sequence 1957 BP; 504 A; 497 C; 454 G; 502 T; 0 other;
     cccaagagca ctgcagccat gggcatccga ggtatgctgc gagccgctgc gctcctgctg        60
     ctcattagga cttggctggc agagagtaac ggccccagtc ccaccccgaa attccacttc       120
     gagctctcct ccagcacgcc tgaagtcatt ctggatctct tcaactgcaa aaactgtgca       180
     aatgaagctg tggttcaaaa gattttggac agggtgctgt caacatatga tgtccgactt       240
     agaccaaatt ttggaggagc tcctgtgcct gtgtcagtat ctatctatgt gtccagtatt       300
     gaacagatct cagaaataaa tatggactat acaatcacaa tgtttttgca tcagacctgg       360
     aaggacacac gcttagctta ctatgaaacc aacctaaacc tgaccctgga ttatcggatg       420
     catgagaagc tctgggttcc tgactgctac tttgtgaata gcaaagatgc ctttgtgcat       480
     gatgtaactg tggagaatcg tgtatttcaa cttcacccag atgggacagt gcgatatggc       540
     atccgactta ccacaacagc agcctgttcc ctggatctgc aaaaattccc tatggacaaa       600
     caatcctgca agctggaggt ggagagctat ggctacactg tcgaagacat tgtgttatcc       660
     tgggaagatg ataatgccat ccacattact gatgggctgc atatccctca gtacacgtac       720
     ctggggagaa caattaccag caaggaagtg tacttctaca caggctccta catgcgcctg       780
     atagtgaagt tccaggttca gagggaagtc cgcagttacc ttgtgcaggt ctattggccc       840
     acggtcctca ccaccattct ctcctggata tcattttgga tgaactatga ttcctctgca       900
     gccagggtaa ctattggact aacttcgatc cttgtcctga ctaccatcga ctcacatatg       960
     cgggataaac tcccccatat ttcctgtatc aaagctattg acatctacat ccttgtatgc      1020
     ctattcttcg ttttcctgtc actgctggag tatgtctaca tcaactacct tttcttcagc      1080
     caagtacctc ggcgtaatca cagaagatgc aggaaaccca ggagagttgt tgcccgatac      1140
     cgctaccaag aagtggtggt agcaaatgtg caggatggcc tgattaatgt ggaagacaga      1200
     gtagaagaca gagctggtcc ccttcctgac agccccatgc aggctcatct ggcaagccag      1260
     gaaagtctag gatccttggt gttcacatca gagcaggccc agctggctac ctcagaaagt      1320
     ctcagtctac tctcttctgc ctcaagccag actcaattgg ccactggaga aagcctgagt      1380
     gatctgccct ccacctctga gcaaacagtg cctgagtgta ccattcactt tcatggcttt      1440
     cttactaatg acagtattat ccccatcaaa atccacagcc gatctgatgc ctgtgatgat      1500
     gaagactccg aagaaagcct aagctctgag gagagccatg gccatggaag cagccacact      1560
     ggaaggctca agctccagat tagccagagg tgtgtgcaag aagcaagttg ggaccttgat      1620
     aaaattgaga tcttacagga tgacatcagt atcacgagca gctggcttgg ccttgatgaa      1680
     caatgcaagg gggatgctga cagtatctgg agccttactg atgaggagct catggcctgt      1740
     gaccaagaga aggacagtag ctcagagtct gaggagaatt gctccccaag ccctgggtgc      1800
     tccttcaatg aagggttctc ttttcagctc tttaaaccta accgggtccc caaggttgat      1860
     agatggtccc gtttcctctt tcctctttcc tttgggctgt tcaatgtggt ttactggtta      1920
     taccatgtct attagtttct catacaccac agccgcg                               1957
//