spacer

EBI Dbfetch

ID   BC119027; SV 1; linear; mRNA; STD; MUS; 2385 BP.
XX
AC   BC119027;
XX
DT   10-AUG-2006 (Rel. 88, Created)
DT   03-DEC-2006 (Rel. 90, Last updated, Version 2)
XX
DE   Mus musculus neural cell adhesion molecule 2, mRNA (cDNA clone MGC:155343
DE   IMAGE:8733776), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2385
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2385
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 00c23d9682aa5ea6dbb37f868347c35d.
DR   Ensembl-Gn; ENSMUSG00000022762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067602; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 2 Row: A Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2385
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:155343 IMAGE:8733776"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: GGTAAAGT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2385
FT                   /gene="Ncam2"
FT                   /note="synonym: RNCAM"
FT   misc_feature    1..2385
FT                   /gene="Ncam2"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS             76..2259
FT                   /codon_start=1
FT                   /gene="Ncam2"
FT                   /product="neural cell adhesion molecule 2"
FT                   /db_xref="GOA:O35136"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR009138"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97282"
FT                   /protein_id="AAI19028.1"
FT                   /translation="MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAI
FT                   GEPESIDWYNPQGEKIISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQE
FT                   ATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRF
FT                   AVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATA
FT                   ERGEEMTLTCKASGSPDPTISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVC
FT                   KATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDG
FT                   VMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEY
FT                   APKFVSNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKM
FT                   ILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFN
FT                   KPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKG
FT                   QGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDK
FT                   EDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDN
FT                   CCEANKGENGGQSWHLNAVGFTFVITMSLSCLF"
XX
SQ   Sequence 2385 BP; 754 A; 496 C; 565 G; 570 T; 0 other;
     gtggcagcgg aaggttctct ctccggggct ggacttaata actttggaac tgtccgccgg        60
     tgtcacgtcc tgaacatgag cctcctcctc tccttctacc tgctcgggtt gcttgtcagg       120
     agcgggcaag ctcttcttca agtgacaatt tcacttagca aagtagagct tagtgtgggt       180
     gagtctaaat tcttcacatg tacagccatt ggtgagcctg agagtatcga ctggtataac       240
     cctcaaggag agaagatcat ttcaacgcag agggttatgc tacagaagga gggtgtcagg       300
     tcacgactca ccatctacaa tgcaaacata gaagatgcag ggatatatcg ctgtcaagcg       360
     acagatgcca aaggacagac acaagaagct acagtagttt tggaaattta ccaaaaactc       420
     accttcagag aagtggtgtc ccctcaagag ttcaagcaag gggaggatgc agaagtggtt       480
     tgcagagtga gcagttcccc agcccctgcg gtcagctggt tgtaccacaa tgaggaagtc       540
     accaccatcc ccgacaatcg gtttgcagtg cttgcaaaca ataatttgca gatcctcaat       600
     atcaataaaa gtgatgaagg tatatacaga tgtgaaggaa gagtggaggc gaggggagag       660
     attgacttcc gggatatcat tgttattgtt aacgttccac cagcaatcat gatgccccag       720
     aagtccttca atgctacagc agagagagga gaagagatga ccttaacatg caaggcctcg       780
     ggctccccag atccaaccat ctcttggttc aggaacggca aactcattga agaaaatgaa       840
     aagtatattt taaagggcag taatacagag ctcactgtca ggaacataat caataaagac       900
     gggggctctt atgtctgcaa agcaacaaac aaggcaggag aagatcaaaa gcaggccttc       960
     cttcaagtct ttgtacagcc tcatatatta caacttaaaa atgagacaac atctgagaat      1020
     ggtcatgtca cactcgtatg tgaagcagaa ggggagcctg ttccagaaat cacatggaaa      1080
     agagccatag atggagtcat gttttctgaa ggtgataaga gtccggatgg ccgcatcgaa      1140
     gttaaagggc agcatggacg ctcttcactg cacattagag atgtgaagtt gtcagattcg      1200
     gggagatatg actgtgaggc cgctagtcgg attggtgggc accagaggag catgcacctg      1260
     gacatcgaat atgctcctaa gtttgtttca aatcagacaa tgtattactc ttgggaagga      1320
     aatccaatca acataagttg tgatgtgaca gcaaacccac ctgcgtcaat ccactggaga      1380
     agagagaaac tgctcttacc agctaagaat acgactcatt taaaaactca cagtgtagga      1440
     agaaagatga tactcgagat tgcccccaca tcagacaatg actttggacg atataactgc      1500
     acagctacta accgtatagg cacaagattt caggaatata ttcttgaatt agcagatgtc      1560
     ccctctagtc cccatggagt gaagattata gagctgtcac agaccacagc caagatctct      1620
     ttcaataaac ccgaatccca tggaggtgtg cctattcatc actatcaagt ggatgtcaaa      1680
     gaagtggcat cagaaacctg gaaaatagta cgctcccatg gagttcaaac gatggttgtt      1740
     ttgagcagtc tggaaccaaa tacgacttac gaaattaggg ttgcagcagt gaatggcaaa      1800
     ggtcaaggag actacagtaa aatagaaata ttccagacac tgccagtccg tgagccaagt      1860
     cccccttcca tacatggaca gccaagcagt ggcaagagtt ttaaaatcag catcaccaag      1920
     caagatgatg gaggggctcc tattttagaa tacattgtaa aatacagaag taaagacaag      1980
     gaagatcagt ggctagagaa gaaggtacag ggaaataaag accacattat cttggagcat      2040
     ctgcagtgga caatgggcta cgaagtgcaa atcacagctg ccaacagact gggatattct      2100
     gagcctactg tatatgagtt cagcatgccc ccaaaaccca acattattaa agataattgc      2160
     tgtgaagcga ataaaggtga aaatggaggc cagtcatggc atctgaatgc tgttgggttt      2220
     acttttgtaa taaccatgag tttgtcttgt ttgttttagt gttctatgtt ctatggtact      2280
     ccctgatcag agataaaaga gtaggtacag gctaatcaaa aattttaatc aacattttca      2340
     gtccagttca atttatgttt acacaattcg ccttccccct gaatt                      2385
//


spacer
spacer