spacer

EBI Dbfetch

ID   BC118971; SV 1; linear; mRNA; STD; MUS; 4003 BP.
XX
AC   BC118971;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus RIKEN cDNA 4932417H02 gene, mRNA (cDNA clone IMAGE:40098204),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4003
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4003
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-JUL-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 86d9cf055260c00e9c8673d2678cdc32.
DR   Ensembl-Gn; ENSMUSG00000025583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026671; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 23 Row: m Column: 5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4003
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="IMAGE:40098204"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: GGCTCTCT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            <1..4003
FT                   /gene="4932417H02Rik"
FT                   /note="synonyms: Raptor, mKIAA1303"
FT   CDS             <1..4003
FT                   /codon_start=2
FT                   /gene="4932417H02Rik"
FT                   /product="4932417H02Rik protein"
FT                   /db_xref="GOA:A4FUW1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="MGI:MGI:1921620"
FT                   /db_xref="UniProtKB/TrEMBL:A4FUW1"
FT                   /protein_id="AAI18972.1"
FT                   /translation="SEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQ
FT                   SWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANL
FT                   QKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVW
FT                   VFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINP
FT                   NHPLAQMPLPPSMKNCIQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKC
FT                   VSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLL
FT                   VASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGT
FT                   AFRHSPFFAEQLTAFQVWLTMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLG
FT                   PWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFL
FT                   SVLADPYMPAEHRTMTAFILAVIVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVA
FT                   ICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHS
FT                   TTIDHNVAMMLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPS
FT                   PAATEGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFS
FT                   PGNLSTSSSASSTLGSPENEEYILSFETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRV
FT                   LLHLAADPYPDVSDLAMKVLNSIAYKATVNARPQRILDTSSLTQSAPASPTNKGMHMHQ
FT                   VGGSPPASSTSSCSLTNDVAKQTVSRDLPSSRPGTAGPTGAQYTPHSHQFPRTRKMFDK
FT                   GPDQTTDDADDAAGHKSFICASMQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWR
FT                   FLRNTRVRKQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWD
FT                   WEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMV
FT                   TAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSC
FT                   VTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAYLQKHPEGHI
FT                   VSVSVNGDVRFFDPRMPESVNVMQIVKGLTALDIHPQANLIACGSMNQFTAIYNGNGEL
FT                   INNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR"
XX
SQ   Sequence 4003 BP; 944 A; 1116 C; 1080 G; 863 T; 0 other;
     gtcggagatg ctgcagtcgc ctcttatggg actcggggag gaagatgagg cggaccttac        60
     agattggaac ttgcctttgg cttttatgaa gaaaagacat tgtgagaaaa tcgaaggctc       120
     caaatcttta gcgcagagct ggagaatgaa ggatcggatg aagacggtga gtgtggcctt       180
     ggtcctgtgc ctgaatgtgg gtgtggatcc tccggatgtg gtgaagacca caccctgtgc       240
     tcggctggaa tgctggatcg atcctctgtc tatgggccct cagaaagctc tggaaaccat       300
     cggtgcaaac ctacagaagc agtatgagaa ctggcagcca agggctcggt acaagcagag       360
     cctcgaccct actgtggatg aagtcaagaa actttgcaca tctctgcgcc ggaacgccaa       420
     ggaggaacgg gtccttttcc actacaatgg ccacggggtg cccaggccta cagtgaatgg       480
     agaggtctgg gtcttcaaca agaactacac tcagtacatc cctctgtcca tatacgacct       540
     gcagacgtgg atgggcagcc catccatctt tgtctacgac tgttccaatg ctggcctcat       600
     cgtcaagtcc ttcaaacagt ttgcactgca gagggagcag gaactagagg tagctgcgat       660
     taacccaaac catccacttg cccagatgcc cttgcctccc tcaatgaaaa actgcatcca       720
     gttggcagcg tgtgaggcac acgagctgct gcccatgatc cctgacctcc cagccgacct       780
     gttcacatcc tgcctcacca ctcccatcaa gattgctctg cgctggtttt gcatgcagaa       840
     gtgcgtgagt ctggtgcctg gagtcacact ggatttgata gaaaagatcc ctggccggct       900
     gaatgaccgg aggacccctc tgggagagct gaactggatc ttcacagcca tcacagatac       960
     catcgcctgg aatgtgctcc ctcgggatct cttccaaaag cttttccgac aggacctgct      1020
     cgtggcaagt ttgtttagaa attttttatt ggcagaaaga atcatgaggt catataactg      1080
     caccccagta agcagcccgc ggctcccccc gacatacatg catgccatgt ggcaggcctg      1140
     ggaccttgct gtggacattt gcctctctca gctgccaacc atcatcgaag agggtactgc      1200
     cttcaggcac agcccattct ttgccgagca gctgacagca ttccaggtgt ggctcacaat      1260
     gggtgtggaa aacaggagcc ccccagagca gctgcccatc gtcctgcagg tgctgctaag      1320
     ccaggtgcac cggctgagag cattggactt gctgggacgg tttttggact tgggcccttg      1380
     ggcggtgagc ttggccctgt cggtgggcat cttcccctat gtactgaagc tgcttcagag      1440
     ctcagcccga gagcttcggc cactccttgt cttcatctgg gccaaaatcc tcgctgtcga      1500
     cagttcgtgc caagctgacc tcgtgaagga caacggtcac aagtacttcc tatccgtctt      1560
     ggcagaccca tacatgccag ctgaacatag gaccatgaca gccttcattc ttgctgtaat      1620
     cgtcaacagc tacacaacag ggcaagaggc ctgcctccag ggaaacctga ttgccatctg      1680
     tctggagcag ctcagcgacc cacacccctt gctacgccag tgggtggcca tttgcctggg      1740
     aaggatctgg cagaacttcg actctgcaag atggtgtggg gtgagagaca gtgcccacga      1800
     aaagctctat agcctcctct ctgaccccat ccctgaggtc cgatgtgcag ctgtatttgc      1860
     cctgggcacc tttgtgggaa attctgctga gaggacagac cactctacca ccattgacca      1920
     caatgtggcc atgatgctgg ctcagctgat caatgatgga agccccatgg tccggaagga      1980
     gctggtggtg gctctgagtc accttgtagt ccaatatgaa agcaatttct gcactgtggc      2040
     cctgcagttc atggaggaag aaaagaacta ccctttgcct tctccagcag ccacagaggg      2100
     agggagcttg accccagttc gagacagccc atgcaccccc agactccgtt cagtgagctc      2160
     ctatgggaac atccgagccg tcacgacagc taggaacctg aacaaatctt tgcagaatct      2220
     gagcttgacg gaagaatcgg gcagctcagt ggccttctct cccgggaacc tcagcaccag      2280
     cagcagtgcc agcagcacct tggggagccc tgagaacgag gagtacatcc tgtccttcga      2340
     gaccatcgac aagatgcggc gtgtgagctc ctactcagcg ctcaactccc tcataggagt      2400
     ttcttttaat agtgtttaca ctcaaatttg gagagtctta ctgcatctgg ctgctgatcc      2460
     ctatccagat gtttctgatt tagccatgaa agtcctcaac agcattgctt acaaggccac      2520
     agtgaacgcc cggccccaac gaatccttga cacatcctct ctcacacagt cggccccagc      2580
     cagcccaacc aacaagggca tgcacatgca ccaggtggga ggctccccgc cagcatctag      2640
     caccagcagc tgcagcctga ccaatgatgt ggccaagcag actgtcagcc gtgacctgcc      2700
     ttccagccgc ccgggtactg ccggccccac aggggcacag tacacccctc actcccacca      2760
     gttccctcga acacgaaaga tgtttgacaa aggccctgat cagaccacag atgatgcaga      2820
     tgatgctgcc ggacacaaga gcttcatttg tgcctctatg cagacagggt tctgtgactg      2880
     gagtgcccgc tactttgccc agccagtcat gaagatcccc gaggagcatg acctagagag      2940
     tcagatccgc aaggagcgtg agtggcggtt cctgaggaac actcgagtca ggaagcaggc      3000
     tcagcaggtc atccagaagg gcatcaccag actggacgat cagatctttc tgaacaggaa      3060
     ccccggcgtt ccttctgtgg tcaaattcca tccctttaca ccatgcatag ctgtcgccga      3120
     caaggacagc atctgttttt gggactggga gaaaggagag aagctggact atttccacaa      3180
     tggcaaccct cggtacacca gggtcaccgc catggagtac ctgaatggtc aggactgttc      3240
     cttgctgctg acagccacag atgatggtgc catcagggtc tggaagaatt ttgctgattt      3300
     ggaaaagaat ccagagatgg tgactgcgtg gcaagggctc tcagacatgc ttccaacaac      3360
     acgaggagct gggatggtgg tagactggga acaagaaact ggccttctca tgagctcagg      3420
     ggacgtgcgc attgtcagga tctgggatac tgaccgggag acgaaggtgc aggacatccc      3480
     cacgggtgct gacagctgtg tgacaagtct gtcttgtgat tcgcaccgtt cgctcattgt      3540
     ggctggcctg ggtgatggct cgatccgtgt ctacgacagg aggatggcac tcagtgaatg      3600
     ccgggtcatg acttaccgag agcacacagc gtgggtggta aaggcctacc tgcagaagca      3660
     ccctgagggc cacatcgtga gtgtgagtgt caatggagat gtgcgcttct tcgaccctcg      3720
     gatgcccgag tctgtgaatg taatgcagat tgtgaagggg ctgacagccc tggacatcca      3780
     cccccaggca aacctgatcg cctgtggctc catgaaccag ttcacagcca tctacaacgg      3840
     aaatggagag ctgatcaaca acatcaaata ctatgatggc ttcatgggcc agcgagtcgg      3900
     ggccatcagc tgcctggctt tccacccaca ctggcctcat ctggccgtag gaagcaatga      3960
     ctactacatt tccgtgtatt cggtggagaa gcgtgtcaga tag                        4003
//


spacer
spacer