spacer

EBI Dbfetch

ID   BC117779; SV 2; linear; mRNA; STD; MUS; 704 BP.
XX
AC   BC117779;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus potassium large conductance calcium-activated channel,
DE   subfamily M, beta member 4, mRNA (cDNA clone MGC:143660 IMAGE:40091866),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-704
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-704
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1c7948e11f356e87c96876301921243f.
DR   Ensembl-Gn; ENSMUSG00000054934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068233; mus_musculus.
XX
CC   On Oct 4, 2006 this sequence version replaced gi:109734855.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 22 Row: l Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..704
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:143660 IMAGE:40091866"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GTATATAT sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..704
FT                   /gene="Kcnmb4"
FT                   /note="synonym: 1700058G18Rik"
FT   CDS             3..635
FT                   /codon_start=1
FT                   /gene="Kcnmb4"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 4"
FT                   /db_xref="GOA:Q9JIN6"
FT                   /db_xref="InterPro:IPR003930"
FT                   /db_xref="MGI:MGI:1913272"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JIN6"
FT                   /protein_id="AAI17780.1"
FT                   /translation="MAKLRVSYEYTEAEDKSIRLGLFLIVSGILSLFIFGFCWLSPALQ
FT                   DLQATAANCTVLSVQQIGEVFECTFTCGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQ
FT                   HQLLTNPKCSYIPPCKRENQKNSESVMNWQQYWKDEIGSQPFTCYFNQHQRPEDVLLQR
FT                   THDEIALLHCFLWPVVAFVVGVLIVVLTICAKSLAVKAEAMKKRKFS"
XX
SQ   Sequence 704 BP; 149 A; 210 C; 200 G; 145 T; 0 other;
     cgatggcgaa gctcagggtg tcttacgagt acacggaagc cgaagacaag agcatccggc        60
     tcggcttgtt cctcatcgtc tccggcatcc tgtcgctctt catcttcggc ttctgctggc       120
     tcagtcccgc cttgcaggat ctgcaagcca cggcggccaa ctgcaccgtg ctgtcggtgc       180
     agcagatcgg cgaggtgttc gagtgcacct tcacctgtgg caccgactgc aggggcacct       240
     cgcagtatcc ctgcgtccag gtgtacgtga acaactccga gtccaactcc agggcgctgc       300
     tacacagcga ccagcaccag ctcctgacca accccaagtg ctcctatatc ccgccctgta       360
     agagagaaaa ccagaagaac tcggagagcg tcatgaactg gcagcagtat tggaaagatg       420
     agatcggttc ccagccattc acttgctatt ttaatcagca tcagagacca gaggacgttc       480
     tcctacagcg cacacacgac gagattgctc tcctgcactg cttcctctgg ccggtggtgg       540
     cgtttgtggt gggtgttctc atcgtggtcc tgaccatctg tgccaagagc ctggcggtca       600
     aggcggaagc catgaagaaa cgcaagttct cttaacgggg aggaggagga ttgtgggaag       660
     ccgagaccag aggttgcctc gtcggcactc gcctgccctg caga                        704
//


spacer
spacer