Dbfetch

ID   BC117759; SV 2; linear; mRNA; STD; MUS; 1896 BP.
XX
AC   BC117759;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   05-OCT-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus frizzled homolog 10 (Drosophila), mRNA (cDNA clone MGC:143562
DE   IMAGE:40090826), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1896
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1896
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2160d9a33325f22ec31782a52ecfabc2.
DR   Ensembl-Gn; ENSMUSG00000081683; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030086; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030096; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030549; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029783; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029933; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029889; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030022; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030590; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028936; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029296; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000117102; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0074568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0074647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0074550; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0074587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074219; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0075055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0074768; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0074170; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0074309; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0074212; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0074369; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074216; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075288; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0073344; mus_musculus_wsbeij.
XX
CC   On Oct 4, 2006 this sequence version replaced gi:109734647.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 22 Row: h Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1896
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:143562 IMAGE:40090826"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: CGTTTCTT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1896
FT                   /gene="Fzd10"
FT                   /note="synonym: Fz-10"
FT   CDS             76..1824
FT                   /codon_start=1
FT                   /gene="Fzd10"
FT                   /product="frizzled homolog 10 (Drosophila)"
FT                   /db_xref="GOA:Q149J3"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026549"
FT                   /db_xref="InterPro:IPR036790"
FT                   /db_xref="MGI:MGI:2136761"
FT                   /db_xref="UniProtKB/TrEMBL:Q149J3"
FT                   /protein_id="AAI17760.1"
FT                   /translation="MQHPGPRLWLVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKD
FT                   IGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPI
FT                   PACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGS
FT                   GMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSR
FT                   DDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIR
FT                   LFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAG
FT                   KKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFV
FT                   LVPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATC
FT                   VIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGI
FT                   TSGVWVWTSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPA
FT                   QPSACV"
XX
SQ   Sequence 1896 BP; 371 A; 567 C; 560 G; 398 T; 0 other;
     agccgcgggc agcagcaaca gcccgtgccc cggagcggcg gccctgagcg gcgctgggac        60
     attgcgggcg ccaccatgca acacccgggc ccgcgcctgt ggttggtgct gcaggtgatg       120
     ataggctcgt gcacggccat cagctccatg gacttagagc gccctggaga cggcaagtgc       180
     cagccggtgg agattcccat gtgcaaggac atcggctaca acaccacccg catgcccaac       240
     ctgatgggtc acgagaacca gcgcgaggcg gccatccaac tgcacgagtt cgcgccgctc       300
     gtggagtacg gctgccacag ccaccttcgc ttcttcctgt gttcgctgta cgcgcccatg       360
     tgcaccgagc aggtctccac acccatccct gcttgccggg tcatgtgcga gcaggcccgg       420
     ctcaagtgct cgccgatcat ggagcagttc aaattcaggt ggccggactc cctggattgc       480
     agcaagctcc ccaacaagaa cgaccccaac tacctgtgca tggaggcacc caacaacggc       540
     tcggatgagc ccagccgggg ctctggcatg tttcctccgc tcttcaggcc ccagaggccc       600
     cacagcgcgc aggagcaccc actaaaggac gggggtccgg ggcgcgcagg ttgtgacaac       660
     ccaggcaagt tccaccatgt ggagaagagc gaatcttgcg caccgctttg cactccgggg       720
     gtggatgtgt attggagccg cgacgacaag cgcttcgctg tggtctggct ggccatctgg       780
     tccgtgctgt gcttcttctc cagcgccttc accgtgctca ccttcctcat cgacccatcg       840
     cgcttcaggt accccgaacg tcctatcatc ttcctctcca tgtgctactg cgtttattcg       900
     gtgggctata tcatccgcct cttcgcgggc gcggagagca tcgcttgtga ccgggacagt       960
     gggcagctgt atgttatcca ggaaggactg gagagcacgg gctgtacctt agtcttcttg      1020
     gtactttact acttcggcat ggccagctct ttatggtggg tggtcctcac cctcacttgg      1080
     ttcctggctg ctggaaagaa gtggggccat gaggccattg aagccaacag cagctacttt      1140
     cacctggcag cttgggccat cccggctgtg aagactatct tgatcttggt gatgcgcagg      1200
     gtggcagggg atgagctcac tggtgtgtgt tatgtgggca gcatggatgt caatgctctg      1260
     accggcttcg tgctggtccc gctggcttgc tacctagtca tcggcacttc cttcatcctg      1320
     tccggctttg tggctttatt ccacatccgg agggtgatga aaacgggtgg ggagaacacg      1380
     gacaagctgg agaagctcat ggtacgcata ggggtcttct ccctcctcta cactgtgccg      1440
     gccacctgtg tgattgcctg ctatttttat gaacgcctca acatggacta ctggaagatg      1500
     ctggccaccc agcacaagtg taagatgaac aatcagacca agacacctga ctgcctgatg      1560
     accacctcca tccctgccgt ggaggtcttc atggtcaaag tgtccatgct gctggtggtg      1620
     ggcatcacca gtggggtgtg ggtctggact tccaagaccc tgcagtcctg gcaacacgta      1680
     tgcagccggg ggctaaagag aaaaagccgg aggaaaccag ccagtgtggt caccagtgca      1740
     gggatctaca aaaaagccca gcacccccaa aaacctcacc ttgggaagta tgaactgccg      1800
     gcccagcctt cagcctgcgt gtgaaggcag agctggctgc aagaacagga cattcggagc      1860
     ccaaatgggc agcttttctt ggttggctgg ttgttg                                1896
//