Dbfetch

ID   BC116986; SV 1; linear; mRNA; STD; MUS; 1453 BP.
XX
AC   BC116986;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 7, mRNA (cDNA clone
DE   MGC:151363 IMAGE:40126305), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1453
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1453
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; dbce9e03810fb94f4c9c3ca695b55837.
DR   Ensembl-Gn; ENSMUSG00000024798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164639; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 1 Row: K Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1453
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:151363 IMAGE:40126305"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: CTCGAGAC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1453
FT                   /gene="Htr7"
FT                   /note="synonym: 5-HT7"
FT   misc_feature    1..1453
FT                   /gene="Htr7"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS             83..1429
FT                   /codon_start=1
FT                   /gene="Htr7"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 7"
FT                   /db_xref="GOA:P32304"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001069"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32304"
FT                   /protein_id="AAI16987.1"
FT                   /translation="MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWM
FT                   PHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCL
FT                   VVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIA
FT                   MDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLF
FT                   GWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGF
FT                   PRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFT
FT                   VCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYR
FT                   SLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLQNCDHCGKKGHDT"
XX
SQ   Sequence 1453 BP; 297 A; 426 C; 415 G; 315 T; 0 other;
     ggcaaggtga atccagccct ggggccggct gccggagcgc ttggcggggg cgccggctcc        60
     atgggcagcg gcgctcggca cgatgatgga cgttaacagc agcggccgcc ccgacctcta       120
     cggccatctc cgctctctca tcctgccgga ggtggggcgc aggctgcagg acctgagccc       180
     cgacggtggc gcccactcgg tggtgagctc ctggatgccg cacctgctga gcggcttccc       240
     agaggtgaca gctagcccgg cgcccacctg ggacgcgccc ccggacaatg tctccggctg       300
     cggggagcag atcaactatg gcagagtcga gaaagttgtg atcggctcca tcctgacgct       360
     catcacgctg ctgacgatcg cgggcaactg cctggtggtg atctcggtgt gctttgtcaa       420
     gaagctccgc cagccctcca actacctgat tgtgtccctg gcgctggctg acctctcggt       480
     ggccgtggcg gtcatgcctt tcgttagtgt cacggacctc atcgggggca agtggatctt       540
     cggccacttc ttctgcaacg tcttcatcgc catggacgtc atgtgctgca cggcctcgat       600
     catgaccctg tgcgtgatca gcatcgacag gtaccttggg atcaccaggc ccctcacgta       660
     ccccgtgagg cagaatggga aatgtatggc caaaatgatt ctgtcggtct ggcttctctc       720
     tgcctccatc accttacctc ctctcttcgg atgggctcag aatgtgaacg atgacaaagt       780
     gtgcttgatc agccaggatt ttggctacac gatctactcc accgcagtgg cgttttatat       840
     ccccatgtcg gtcatgctgt tcatgtacta tcagatttac aaggccgcca ggaagagcgc       900
     agccaaacac aagttctcag gcttcccacg cgtgcagccg gagagcgtca tctccctgaa       960
     tggcgtggtg aaactccaga aggaggtgga agagtgtgcg aacctttcga gactgctcaa      1020
     acacgaaagg aaaaacattt ccatcttcaa gagggaacag aaagcagcca ctaccttggg      1080
     gatcatcgtg ggagccttca cggtgtgctg gctgccgttt ttcctcttgt ccacagcaag      1140
     gccctttatc tgtggcacct cctgtagctg catcccgctg tgggtggaga ggacatgtct      1200
     gtggctgggc tatgcaaact ctctcattaa cccttttata tatgccttct tcaaccggga      1260
     cctgaggacc acctatcgta gcctactcca gtgccagtac cggaatatca accggaagct      1320
     ctctgctgca ggcatgcacg aagccctgaa acttgctgag aggcctgaga gaagcgagtt      1380
     tgtgctacaa aactgtgacc actgtgggaa aaaaggtcat gatacatgat ccagagcgga      1440
     accctggaga aga                                                         1453
//