spacer

EBI Dbfetch

ID   BC116982; SV 1; linear; mRNA; STD; MUS; 1668 BP.
XX
AC   BC116982;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus galanin receptor 2, mRNA (cDNA clone MGC:151359
DE   IMAGE:40126301), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1668
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1668
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 42894832feb27f0e8edc680fdf1fdeca.
DR   Ensembl-Gn; ENSMUSG00000020793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055872; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 1 Row: K Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1668
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:151359 IMAGE:40126301"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCTGGGGG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1668
FT                   /gene="Galr2"
FT                   /note="synonym: mGalR"
FT   CDS             505..1620
FT                   /codon_start=1
FT                   /gene="Galr2"
FT                   /product="galanin receptor 2"
FT                   /db_xref="GOA:O88854"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000405"
FT                   /db_xref="InterPro:IPR003907"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1337018"
FT                   /protein_id="AAI16983.1"
FT                   /translation="MNGSDSQGAEDSSQEGGGGWQPEAVLVPLFFALIFLVGAVGNALV
FT                   LAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI
FT                   FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYY
FT                   SQSQLANLTVCHPAWSAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAA
FT                   GSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSY
FT                   ANSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTD
FT                   LTQVSEAAGPLVPAPALPNCTTLSRTLDPAC"
XX
SQ   Sequence 1668 BP; 295 A; 540 C; 474 G; 359 T; 0 other;
     tggcaggctg aggtattcca aggatttaga aatgggagag gcctagaaat atggctggcc        60
     ataacacttt gtgtttgggg gaagggggcg ttgaggggtg accaaccaca gggccagtaa       120
     tctgtgtcag ccccctcatt ccaagaatgg gatggatctc ttaaaggcgc cccatgtccc       180
     acacgcaccc tgctccctcc accaatccag gtacagtgtg actcgctagt gaccgactca       240
     agtctaaagc agagcgggtc ccaggacttg agcgcgggag ccaaatggag tcagggtcat       300
     tcgacagctc ctctctcggc tgcaggccgg agcggggtac catcctatac tctgggtgct       360
     cgctcctcct cccgtccccc gcgcacccct gctctggctc ttggagctcc acagtcttgc       420
     tggggcgctg cagccaggga gctgcgcgct caccaagacc cggacggctg cgggagccag       480
     ggcggcgtct gctttggtga tatcatgaat ggctcggaca gccagggggc ggaggactcg       540
     agccaggaag gtggcggcgg ctggcagccc gaggcggtcc tcgtacccct atttttcgcg       600
     ctcatcttcc tcgtgggcgc tgtgggcaac gcgctggtgc tggcggtgct gctgcgcggc       660
     ggccaggcgg tcagcaccac gaacctattc atcctcaacc tgggtgtggc cgacctgtgt       720
     ttcatcctgt gctgcgtgcc tttccaggcc accatctata ccctggacga ttgggtgttt       780
     ggctcactgc tctgcaaggc cgttcatttc ctcatcttcc tcactatgca cgccagcagc       840
     ttcacgctgg ccgctgtctc cctggacagg tatctggcca tccgctaccc gctgcactcc       900
     cgagagttgc gcacacctcg aaacgcgctg gcggccatcg ggctcatctg ggggctagca       960
     ctgctcttct ccgggcccta cctgagctac tacagtcagt cgcagctggc caatctgacg      1020
     gtgtgccacc cagcgtggag cgcaccacga cgtcgcgcca tggacctctg cacttttgtc      1080
     tttagctacc tgttgccagt gctggtgctc agcctgacct atgcgcgcac cctgcactac      1140
     ctctggcgca cagttgaccc agtagctgca ggctcaggtt cccagcgcgc caagcgcaag      1200
     gtgacacgga tgatcgtcat cgtggcggta ctcttctgcc tctgttggat gccccaccac      1260
     gcgcttatcc tctgcgtgtg gtttggtcgc tttccgctca cgcgtgccac ttacgccctg      1320
     cgcatccttt cacatctagt atcttatgcc aactcgtgtg tcaaccccat cgtttatgct      1380
     ctggtctcca agcatttccg caaaggtttc cgcaaaatct gcgcgggcct gctacgccgt      1440
     gccccgagga gagcttcagg ccgagtgtgc atcctggcgc ctggaaacca tagtggtggc      1500
     atgctggaac ctgagtccac agacctgaca caggtgagcg aggcagccgg gcccctcgtc      1560
     cccgcacccg cacttcccaa ctgcacaacc ttgagtagaa ccctcgatcc agcctgttaa      1620
     aggaccaaag ggcatctaac agcttctgga cagtgtgacc agacgata                   1668
//


spacer
spacer