spacer

EBI Dbfetch

ID   BC116704; SV 1; linear; mRNA; STD; MUS; 1369 BP.
XX
AC   BC116704;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus G protein-coupled receptor 82, mRNA (cDNA clone MGC:144689
DE   IMAGE:40104936), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1369
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1369
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d2295dac21cdb86a35e7798cbe448132.
DR   Ensembl-Gn; ENSMUSG00000047678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053659; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 25 Row: h Column: 10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1369
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:144689 IMAGE:40104936"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GAGAGACG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1369
FT                   /gene="Gpr82"
FT   CDS             274..1260
FT                   /codon_start=1
FT                   /gene="Gpr82"
FT                   /product="G protein-coupled receptor 82"
FT                   /db_xref="GOA:Q8BZR0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441734"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BZR0"
FT                   /protein_id="AAI16705.1"
FT                   /translation="MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIG
FT                   KKTSTHIYLANLVTANLLVCTAMPFMGIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMF
FT                   VSLLILSWIAISRYATLMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVV
FT                   LVIIIPVTLYYSVVEATEEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYY
FT                   SLVSHLRRVRTCTSITEKDLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGD
FT                   CQQLNYLIEAKNILTCLASARSSTDPIIFLLLDKTFKKTLYGLLTKS"
XX
SQ   Sequence 1369 BP; 422 A; 284 C; 251 G; 412 T; 0 other;
     tggttgccct ctccagcttc tcaggatcaa tctttgagta agcccaactt ctcatcatct        60
     acgtactaga cgagtgactc tactcatact gattaaggat actggaagag tgaagatcag       120
     agaactgtga gtgtgaaaca gtcaatgagc ataagctact cagacagacg aaggacttat       180
     ccatcgcttt aagtactgtt gcttttactt taagcagacc actgtgacaa cgagaaaagc       240
     tcctgtgaca aaaatcaaga aaatctaata taaatgacta ataactcgac atgcattcaa       300
     ccatccgtga tttctaccac agctttaccg gtcacttaca tctttttgtt tattattggt       360
     ctctttggaa actcacttgc tcagtgggta tttttaacaa aaataggtaa gaaaacatca       420
     acacatatct acttggcaaa tcttgtgact gcaaacttac ttgtgtgcac tgctatgcct       480
     ttcatgggta tatatttctt gagaggtttt tattggaaat atcaatctgt acaatgcaga       540
     ctggtcaatt ttttgggaac tctttctatg catgtaagta tgtttgtcag cctcttaatt       600
     ttaagctgga ttgccataag ccgctatgct accttaatga aaaaggagtc caagcaagag       660
     gccacctcat gctacgagag aatgttttat ggtcacgtac tgaaaagatt tcgccagccc       720
     aactttgcca gaacaatgtg tatttacata tggggagttg tgcttgtcat aattattcca       780
     gttaccctat actactcagt agtcgaggct acagaagaag gacagagcca gtgctacaat       840
     cggcagatgg aactgggagc cagaccttct cagattgcgg gtctcattgg aaccacattt       900
     attggattct cctttttagt agtagtgaca tcatactatt ctcttgtcag ccatctgcga       960
     agagtaagga cctgtacctc cattaccgag aaagatttga cctacagatc tgtgaaaaga      1020
     caccttttga tcatccaggt cctcctagta gtttgctttc ttccatatag tatttttaaa      1080
     cccatttttt atgttctgca ccagagagaa ggagactgtc agcagctgaa ttatttaata      1140
     gaagcaaaaa acatcctcac ttgtcttgca tcagccagaa gtagtacaga ccccattata      1200
     tttcttttat tagataaaac attcaagaag acactatatg gtctccttac aaaatcttaa      1260
     ttcactgcac attctaacat atggttgact tttggataga aaacaccaca aaataggaaa      1320
     aaaaatgcat gtgactctta gtgacattaa cgggcaccaa gaaaacctc                  1369
//


spacer
spacer