spacer

EBI Dbfetch

ID   BC116654; SV 1; linear; mRNA; STD; MUS; 1344 BP.
XX
AC   BC116654;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   01-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 5A, mRNA (cDNA clone
DE   MGC:144666 IMAGE:40104769), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1344
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1344
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e9cf00499a6a6ffa44255ed09f8b66da.
DR   Ensembl-Gn; ENSMUSG00000039106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036227; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 25 Row: g Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1344
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:144666 IMAGE:40104769"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TGAAAATG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1344
FT                   /gene="Htr5a"
FT   CDS             195..1268
FT                   /codon_start=1
FT                   /gene="Htr5a"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /db_xref="GOA:P30966"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001397"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30966"
FT                   /protein_id="AAI16655.1"
FT                   /translation="MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLT
FT                   LLGFLAAATFTWNLLVLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSG
FT                   RRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMIL
FT                   LTWALSTVISLAPLLFGWGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWK
FT                   IYRAAKFRMGSRKTNSVSPVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQ
FT                   RAALMVGILIGVFVLCWFPFFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTA
FT                   FNRSYSSAFKVFFSKQQ"
XX
SQ   Sequence 1344 BP; 256 A; 399 C; 341 G; 348 T; 0 other;
     tgggctgtgc tgcttgtagc ccagcaccct cctctctgct acaatttcct ccggactctg        60
     actgggtgga gactgaggcc aggttcttgg ctcttagcaa aatcctctcc attggccatc       120
     ggtcgcaaac atctagattg acttcagtgg gctcggtggc aacacagtct aaacacaggt       180
     gtcctgggac agcaatggat ctgcctgtaa acttgacctc cttttctctc tctactccct       240
     cctctttgga acctaaccgc agcttggaca cggaagtcct gcgccctagt cggccttttc       300
     tctcagcttt ccgagtgcta gtcctgactt tgttgggctt tctagctgcg gccacattca       360
     cttggaacct gctggtgctg gctaccatcc tcaaggtacg caccttccac cgagtaccac       420
     acaacctggt agcttccatg gccatctcgg atgtgctagt ggctgtgctg gttatgccac       480
     tgagcctggt acatgagctg tctgggcgcc gctggcagct gggccggcgt ctatgccagc       540
     tgtggatcgc atgtgacgtg ctctgctgta ctgccagcat ctggaatgtg acagcaatag       600
     ctctggaccg ctactggtca atcacgcgcc acctggagta cacactccgt acccgcaagc       660
     gtgtctccaa tgtgatgatc ctgctcacct gggcactctc cactgtcatc tctctggctc       720
     cactgctatt tggctgggga gagacttatt ctgagcccag tgaggaatgc caagtcagtc       780
     gcgagccttc ctacaccgtg ttctccaccg tgggtgcctt ctacctgccg ctgtgcgtgg       840
     tgctctttgt gtactggaaa atttacaggg cggcgaaatt ccgcatgggc tccaggaaga       900
     ccaacagcgt ctcccccgta cccgaagctg tggaggtgaa gaatgctacg caacatcccc       960
     agatggtgtt cacggtccgc catgccaccg tcactttcca gacagaaggg gatacgtgga      1020
     gggagcagaa ggagcaaagg gcagccctca tggtgggcat cctcatcgga gtgtttgtgc      1080
     tctgctggtt ccctttcttc gtcacagagc tcatcagtcc cctgtgttcc tgggacgtcc      1140
     ctgccatctg gaagagcatc ttcctgtggt tgggctattc taattccttc ttcaacccac      1200
     tcatctacac agcattcaac aggagctaca gcagtgcttt caaggtcttc ttctccaagc      1260
     aacaatgaga gaccacatgg gagtgccttc ttcccatagc ttgtagctca gtgggttata      1320
     ttgtcccatg aacctttgca ggct                                             1344
//


spacer
spacer