spacer

EBI Dbfetch

ID   BC116652; SV 1; linear; mRNA; STD; MUS; 1356 BP.
XX
AC   BC116652;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 6, mRNA (cDNA clone
DE   MGC:144682 IMAGE:40104888), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1356
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1356
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 599117aa86de7d8ea5012934ded0478f.
DR   Ensembl-Gn; ENSMUSG00000028747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105802; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 25 Row: g Column: 24.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1356
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:144682 IMAGE:40104888"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert"
FT                   /db_xref="taxon:10090"
FT   gene            1..1356
FT                   /gene="Htr6"
FT                   /note="synonym: 5-HT6"
FT   CDS             29..1351
FT                   /codon_start=1
FT                   /gene="Htr6"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 6"
FT                   /db_xref="GOA:Q14AW8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1196627"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AW8"
FT                   /protein_id="AAI16653.1"
FT                   /translation="MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANS
FT                   LLIALICTQPALRNTSNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTA
FT                   FDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLL
FT                   LGWHELGKARTSAPGQCRLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQV
FT                   ASLTTGTATAGQALETLQVPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFV
FT                   TWLPFFVASIAQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCV
FT                   HCPPEHRASPASPSMWTSHSGARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLL
FT                   LPGEATRDPPPPTRAPTVVNFFVTDSVEPEIRQHPLGSPMN"
FT   misc_difference 781
FT                   /gene="Htr6"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 844
FT                   /gene="Htr6"
FT                   /note="'G' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 895
FT                   /gene="Htr6"
FT                   /note="'A' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 997
FT                   /gene="Htr6"
FT                   /note="'G' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1042
FT                   /gene="Htr6"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1045
FT                   /gene="Htr6"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1231
FT                   /gene="Htr6"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
XX
SQ   Sequence 1356 BP; 204 A; 491 C; 378 G; 283 T; 0 other;
     cctgtcctgg tcctcaaccc tagtccccat ggttccagag cccggccctg tcaacagtag        60
     caccccagcc tggggccccg ggccaccgcc agccccaggg ggcagcggct gggtggccgc       120
     tgcgctgtgc gtggtcatcg tgctgacggc agccgccaat tcgctgctga tcgcgctcat       180
     ctgcacgcag cccgcgctgc gcaacacgtc taacttcttc ctggtgtcgc tcttcacgtc       240
     ggacctgatg gtgggattgg tggtgatgcc cccagccatg ctgaacgcgc tgtatgggcg       300
     ctgggtgcta gctcgcggcc tctgtctgct ttggaccgcc ttcgacgtga tgtgctgcag       360
     cgcctccatt ctcaacctct gcctcatcag cctggaccgc tacctgctca tcctctcgcc       420
     gctgcgctac aagctgcgca tgacagcccc gcgtgccctg gcgctcatcc tgggtgcctg       480
     gagcctcgcc gcgctggcct ccttcctgcc cctcttgctg ggctggcatg aactgggcaa       540
     agctcgaaca tctgccccgg gccagtgccg cctattggcc agcctgcctt atgtcctcgt       600
     ggcgtccggc gtcacctttt tcctgccttc gggtgccatc tgcttcacct actgcaggat       660
     cttgctggct gcccgcaagc aggcggtgca agtggcctcg ctcaccacgg gcacggctac       720
     ggctggccag gccttggaaa ccttgcaggt gcccaggaca ccacgcccag ggatggagtc       780
     cgctgacagt aggcgtctga ccaccaagca tagcaggaag gccttgaagg ccagcctgac       840
     cctgggcatc ctgctgagca tgttctttgt cacctggctg cccttctttg tggcaagcat       900
     agctcaggcc gtatgtgact gcatctctcc aggtctcttc gatgtcctca catggctggg       960
     atactgtaat agcaccatga accctatcat ctatccgctc ttcatgcggg acttcaagag      1020
     ggccctgggc aggttcgtgc catgcgtcca ctgtcccccg gagcaccggg ccagccccgc      1080
     ctccccctcc atgtggacct ctcacagtgg tgccaggcca ggcctcagcc tgcagcaggt      1140
     gctgcccctg cctctgccac ccaactcaga ttcagactca gcttcagggg gcacctcggg      1200
     cctgcagctc acagcccagc ttttgctgcc cggagaggcg acccgggacc ccccgccacc      1260
     caccagggcc cctactgtgg tcaacttctt cgtcacagac tctgtggagc ctgagatacg      1320
     gcagcatcca cttggttccc ccatgaactg accagg                                1356
//


spacer
spacer