spacer

EBI Dbfetch

ID   BC116177; SV 1; linear; mRNA; STD; MUS; 274 BP.
XX
AC   BC116177;
XX
DT   05-MAY-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus defensin beta 3, mRNA (cDNA clone MGC:129395 IMAGE:40049232),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-274
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-274
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d083c3cbbb0438139375bb86027916e3.
DR   Ensembl-Gn; ENSMUSG00000039775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033852; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 11 Row: k Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..274
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:129395 IMAGE:40049232"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GACCTATA sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..274
FT                   /gene="Defb3"
FT                   /note="synonym: mBD-3"
FT   CDS             13..204
FT                   /codon_start=1
FT                   /gene="Defb3"
FT                   /product="defensin beta 3"
FT                   /db_xref="GOA:Q9WTL0"
FT                   /db_xref="InterPro:IPR001855"
FT                   /db_xref="InterPro:IPR006080"
FT                   /db_xref="MGI:MGI:1351612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL0"
FT                   /protein_id="AAI16178.1"
FT                   /translation="MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGN
FT                   TRQIGSCGVPFLKCCKRK"
XX
SQ   Sequence 274 BP; 84 A; 61 C; 59 G; 70 T; 0 other;
     caggcttcag tcatgaggat ccattacctt ctctttgcat ttctcctggt gctgctgtct        60
     ccacctgcag cttttagcaa aaaaatcaac aatccagtaa gttgtttgag gaaaggaggc       120
     agatgctgga atcggtgcat tggcaacact cgtcagattg gcagttgtgg agttcctttc       180
     ctcaaatgct gcaagagaaa atagagaaga ccaagatccc gttaaacaaa gaaaacacca       240
     gaatttgctc ctccatgaag atggacaaaa ctta                                   274
//


spacer
spacer