spacer

EBI Dbfetch

ID   BC116176; SV 2; linear; mRNA; STD; MUS; 276 BP.
XX
AC   BC116176;
XX
DT   05-MAY-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus defensin beta 3, mRNA (cDNA clone MGC:129394 IMAGE:40049224),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-276
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d86ec79bd55d9fae93183f39333ba08d.
DR   Ensembl-Gn; ENSMUSG00000039775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033852; mus_musculus.
XX
CC   On Oct 4, 2006 this sequence version replaced gi:94574446.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 11 Row: k Column: 13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:129394 IMAGE:40049224"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: NA"
FT                   /db_xref="taxon:10090"
FT   gene            1..276
FT                   /gene="Defb3"
FT                   /note="synonym: mBD-3"
FT   CDS             14..205
FT                   /codon_start=1
FT                   /gene="Defb3"
FT                   /product="defensin beta 3"
FT                   /db_xref="GOA:Q9WTL0"
FT                   /db_xref="InterPro:IPR001855"
FT                   /db_xref="InterPro:IPR006080"
FT                   /db_xref="MGI:MGI:1351612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL0"
FT                   /protein_id="AAI16177.1"
FT                   /translation="MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGN
FT                   TRQIGSCGVPFLKCCKRK"
XX
SQ   Sequence 276 BP; 85 A; 62 C; 59 G; 70 T; 0 other;
     ccaggcttca gtcatgagga tccattacct tctctttgca tttctcctgg tgctgctgtc        60
     tccacctgca gcttttagca aaaaaatcaa caatccagta agttgtttga ggaaaggagg       120
     cagatgctgg aatcggtgca ttggcaacac tcgtcagatt ggcagttgtg gagttccttt       180
     cctcaaatgc tgcaagagaa aatagagaag accaagatcc cgttaaacaa agaaaacacc       240
     agaatttgct cctccatgaa gatggacaaa acttaa                                 276
//


spacer
spacer