spacer

EBI Dbfetch

ID   BC115960; SV 1; linear; mRNA; STD; MUS; 1967 BP.
XX
AC   BC115960;
XX
DT   02-MAY-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus interleukin 4 induced 1, mRNA (cDNA clone MGC:141133
DE   IMAGE:40054305), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1967
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1967
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-APR-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c9b18d75946458319cfcfd82f30da593.
DR   Ensembl-Gn; ENSMUSG00000074141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033015; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 20 Row: h Column: 22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1967
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:141133 IMAGE:40054305"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GTTTGTTG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1967
FT                   /gene="Il4i1"
FT   CDS             39..1931
FT                   /codon_start=1
FT                   /gene="Il4i1"
FT                   /product="interleukin 4 induced 1"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAI15961.1"
FT                   /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
XX
SQ   Sequence 1967 BP; 424 A; 557 C; 624 G; 362 T; 0 other;
     gcccaagaga gctgaagaca gcagctgcca cttgagccat ggctgggctg gccctgcgtc        60
     ttgtcctggc ggccaccctc cttggtctgg caggctctct ggactggaag gcagcctcca       120
     gcttgaaccc tattgagaag tgtatggagg accacgatta tgagcagcta ctcaaggtgg       180
     tgaccttggg cctcaatcgg acttcgaagc cccagaaggt ggtagtggtt ggtgcaggcg       240
     tggcagggct ggtagcagcc aagatgctca gtgatgcagg acacaaggtc accatcctgg       300
     aggcagataa caggattggg ggccgtatct tcactttccg ggatgagaag acaggctgga       360
     taggggagct tggggccatg cgaatgccca gctctcacag gatcttgcac aagctctgca       420
     ggaccctggg cctcaacctg actcagttca cacagtatga tgagaacacg tggacggagg       480
     tgcataatgt gaagctgcga aactatgtgg tggagaagat gccagaaaag ctgggctaca       540
     acctgaacaa cagggaaagg ggccattccc cagaggacat ctaccagatg gcactcaaca       600
     aggccttcaa agacctcaag gccttgggct gcaagaaagc catgaataag ttcaacaagc       660
     atacgcttct ggaatacctc ctcgaggagg gcaacctgtc ccggccggct gtgcagctcc       720
     tgggagatgt gatgtccgag gagggcttct tctacctcag ctttgcagaa gccttacgtg       780
     cgcacgcctg cctgagcgat agactccggt acagccgcat cgtaggtggc tgggacctgc       840
     ttccgcgagc tctgctgagc tcactgtccg gggcgctgct actgaacgcg cctgtggtgt       900
     cgatcactca ggggaggaac gatgtacgcg tgcacattgc cacctcgctt cacagcgaga       960
     agacgctgac agccgacgtg gtgctgctga ctgccagtgg acccgcgctg cagcgcatta      1020
     ccttctcgcc gcccttgact cgcaagaggc aggaggcact gcgcgcgctt cactacgtag      1080
     cagccagcaa ggtttttctg agtttccgtc ggcccttctg gcacgaggag cacatcgagg      1140
     gcggccactc caacactgac cgcccatcgc gcctcatatt ctatcccgcg cggggcgagg      1200
     gctcactgct tctggcctcc tacacgtggt cggacgctgc agcccccttc gctggactga      1260
     gcaccgacca gaccctgcgt ttggtgctcc aggacgtggc ggccctgcac gggcctgtgg      1320
     tgttccggct gtgggacggc aggggtgtgg tcaagcgctg ggcagaggac ccgcatagcc      1380
     agggaggctt cgtggtgcag ccgccattgt acgggcgcga ggctgaggac tatgactggt      1440
     cagccccctt cggccgcatt tacttcgcgg gcgagcacac agctctcccg catggctggg      1500
     tagagaccgc tgtcaagtcc gggttgcggg ccgcggtgag aatcaataat aactatgggt      1560
     acggggaggt cgacccccag atgatggagc atgcatatgc agaggccaac tatctggacc      1620
     agtatcctga aggggagagg cccgaggagc agcaggcgcg ggaagaagtc agcccagatg      1680
     aacaggagcc ctctcacaaa cacttgttgg tggaaacgag ccccgagggg cagcaacacg      1740
     cgtttgtgga ggccattccc gagctgcagg gacacgtgtt cgtggagact gtcccccagg      1800
     agaaggggca cgcccaccag aatatatatc cttcggagca tgtacaggtg catggggaag      1860
     tcatccctga gtggcatggt catgggggat ctggcacccc gcaaatgcac cgagtggggg      1920
     accactccta atcgcaaaga ggaagtgagc acccagctcc taagcca                    1967
//


spacer
spacer