Dbfetch

ID   BC115457; SV 1; linear; mRNA; STD; MUS; 783 BP.
XX
AC   BC115457;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus calcium channel, voltage-dependent, gamma subunit 6, mRNA
DE   (cDNA clone MGC:144252 IMAGE:40100159), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-783
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-783
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-APR-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0e0b8856c1f647d325d7aca5b72b52cf.
DR   Ensembl-Gn; ENSMUSG00000078815; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183200; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 24 Row: a Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..783
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:144252 IMAGE:40100159"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: GTCTTTAA sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..783
FT                   /gene="Cacng6"
FT   CDS             1..783
FT                   /codon_start=1
FT                   /gene="Cacng6"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   6"
FT                   /db_xref="GOA:Q14C42"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="InterPro:IPR008370"
FT                   /db_xref="MGI:MGI:1859168"
FT                   /db_xref="UniProtKB/TrEMBL:Q14C42"
FT                   /protein_id="AAI15458.1"
FT                   /translation="MMWSNFFMQEEDRRRTAVGRRRAQEQQNLGLTPEREGKIKLGLLV
FT                   AIVGATLAVLAVGTEFWVELNTYKTNGSAVCEAAHLGLWKVCIKRLWQADVPAGRETCG
FT                   PAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLAAAVIAVLGLTAMALGCLCVIMVL
FT                   SKGAESLLRLGAVCFGLSGLLLFVSLEVFRHSVGALLQGVNPETPPAPRLAYEYSWSLG
FT                   CGVGAGLILLLGGVCFLLLTLPSWPWRSLCPKWGGPTA"
XX
SQ   Sequence 783 BP; 141 A; 218 C; 253 G; 171 T; 0 other;
     atgatgtggt ctaacttctt catgcaagag gaagaccgac gccggacagc tgtgggccgg        60
     cgtcgtgccc aagaacagca gaatctcggc ttgactccgg agcgagaggg caagatcaag       120
     ctggggttgc tggtggcaat cgtgggtgct acgctggctg tgctggctgt gggcaccgag       180
     ttctgggtgg aactcaatac atacaagacc aatggcagcg ccgtctgtga ggccgcccat       240
     ttggggctgt ggaaggtgtg catcaagcga ctgtggcagg cggatgtgcc cgcgggcagg       300
     gagacctgtg gcccagctga gctgccagga gaagcaaact gcacctactt caaattcttc       360
     accacggggg aaaatgcgcg catcttccag cgaaccacca agaaagaggt aaacctggca       420
     gctgccgtga tagctgtgct gggcctgacg gccatggcct tgggctgcct ctgtgtcatc       480
     atggtgctca gtaaaggtgc agagtccctg ctccgattgg gagctgtctg ctttggcctc       540
     tcaggcctgc tgctctttgt cagcctggag gtgttccggc attccgtagg agccctgctg       600
     cagggagtca accctgagac ccctccagct ccacgcctgg cctatgagta ttcctggtcc       660
     ttaggctgtg gtgtaggcgc tggtctaatc ctgctgctgg ggggagtctg tttcctcctg       720
     ctcaccttgc cttcctggcc ctggaggtca ctgtgcccca agtggggtgg cccaaccgcc       780
     tag                                                                     783
//