spacer

EBI Dbfetch

ID   BC114344; SV 2; linear; mRNA; STD; MUS; 275 BP.
XX
AC   BC114344;
XX
DT   03-MAR-2006 (Rel. 87, Created)
DT   05-OCT-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus defensin beta 3, mRNA (cDNA clone MGC:129397 IMAGE:40049236),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-275
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-275
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7a62cd9dd39ceefb4cb2dd1e57858359.
DR   Ensembl-Gn; ENSMUSG00000039775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033852; mus_musculus.
XX
CC   On Oct 4, 2006 this sequence version replaced gi:89130364.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 11 Row: k Column: 12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..275
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:129397 IMAGE:40049236"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: CGTAACTT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..275
FT                   /gene="Defb3"
FT                   /note="synonym: mBD-3"
FT   CDS             10..201
FT                   /codon_start=1
FT                   /gene="Defb3"
FT                   /product="defensin beta 3"
FT                   /db_xref="GOA:Q9WTL0"
FT                   /db_xref="InterPro:IPR001855"
FT                   /db_xref="InterPro:IPR006080"
FT                   /db_xref="MGI:MGI:1351612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL0"
FT                   /protein_id="AAI14345.1"
FT                   /translation="MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGN
FT                   TRQIGSCGVPFLKCCKRK"
XX
SQ   Sequence 275 BP; 84 A; 62 C; 58 G; 71 T; 0 other;
     gcttcagtca tgaggatcca ttaccttctc tttgcatttc tcctggtgct gctgtctcca        60
     cctgcagctt ttagcaaaaa aatcaacaat ccagtaagtt gtttgaggaa aggaggcaga       120
     tgctggaatc ggtgcattgg caacactcgt cagattggca gttgtggagt tcctttcctc       180
     aaatgctgca agagaaaata gagaagacca agatcccgtt aaacaaagaa aacaccagaa       240
     tttgctcctc catgaagatg gacaaatctt aaacc                                  275
//


spacer
spacer