spacer

EBI Dbfetch

ID   BC113521; SV 1; linear; mRNA; STD; HUM; 1339 BP.
XX
AC   BC113521;
XX
DT   21-NOV-2006 (Rel. 89, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens choline kinase beta, mRNA (cDNA clone MGC:142081
DE   IMAGE:8322573), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1339
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1339
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-FEB-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b67c02a424482145e72f72eec21bd93f.
DR   Ensembl-Gn; ENSG00000100288; homo_sapiens.
DR   Ensembl-Tr; ENST00000406938; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCB Plate: 5 Row: g Column: 19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1339
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_311"
FT                   /clone="MGC:142081 IMAGE:8322573"
FT                   /tissue_type="Brain, cerebellum, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CATAACGC"
FT                   /db_xref="taxon:9606"
FT   gene            1..1339
FT                   /gene="CHKB"
FT                   /note="synonym: CHETK"
FT   misc_feature    1..1339
FT                   /gene="CHKB"
FT                   /note="This cDNA sequence aligns to the human reference
FT                   genome (build 36) without differences"
FT   CDS             64..1251
FT                   /codon_start=1
FT                   /gene="CHKB"
FT                   /product="choline kinase beta"
FT                   /db_xref="GOA:Q9Y259"
FT                   /db_xref="H-InvDB:HIT000386974.6"
FT                   /db_xref="HGNC:HGNC:1938"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:2IG7"
FT                   /db_xref="PDB:3FEG"
FT                   /db_xref="PDB:3LQ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y259"
FT                   /protein_id="AAI13522.2"
FT                   /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDA
FT                   ERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLR
FT                   LYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVL
FT                   SAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEM
FT                   GNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF
FT                   CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLV
FT                   EVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS"
XX
SQ   Sequence 1339 BP; 288 A; 387 C; 398 G; 266 T; 0 other;
     gaaccgagcc cgtccgaagg gagcggagcg cagcctggcc tggggcccgg tcgagcccgc        60
     gccatggcgg ccgaggcgac agctgtggcc ggaagcgggg ctgttggcgg ctgcctggcc       120
     aaagacggct tgcagcagtc taagtgcccg gacactaccc caaaacggcg gcgcgcctcg       180
     tcgctgtcgc gtgacgccga gcgccgagcc taccaatggt gccgggagta cttgggcggg       240
     gcctggcgcc gagtgcagcc cgaggagctg agggtttacc ccgtgagcgg aggcctcagc       300
     aacctgctct tccgctgctc gctcccggac cacctgccca gcgttggcga ggagccccgg       360
     gaggtgcttc tgcggctgta cggagccatc ttgcagggcg tggactccct ggtgctagaa       420
     agcgtgatgt tcgccatact tgcggagcgg tcgctggggc cccagctgta cggagtcttc       480
     ccagagggcc ggctggaaca gtacatccca agtcggccat tgaaaactca agagcttcga       540
     gagccagtgt tgtcagcagc cattgccacg aagatggcgc aatttcatgg catggagatg       600
     cctttcacca aggagcccca ctggctgttt gggaccatgg agcggtacct aaaacagatc       660
     caggacctgc ccccaactgg cctccctgag atgaacctgc tggagatgta cagcctgaag       720
     gatgagatgg gcaacctcag gaagttacta gagtctaccc catcgccagt cgtcttctgc       780
     cacaatgaca tccaggaagg gaacatcttg ctgctctcag agccagaaaa tgctgacagc       840
     ctcatgctgg tggacttcga gtacagcagt tataactata ggggctttga cattgggaac       900
     catttttgtg agtgggttta tgattatact cacgaggaat ggcctttcta caaagcaagg       960
     cccacagact accccactca agaacagcag ttgcatttta ttcgtcatta cctggcagag      1020
     gcaaagaaag gtgagaccct ctcccaagag gagcagagaa aactggaaga agatttgctg      1080
     gtagaagtca gtcggtatgc tctggcatcc catttcttct ggggtctgtg gtccatcctc      1140
     caggcatcca tgtccaccat agaatttggt tacttggact atgcccagtc tcggttccag      1200
     ttctacttcc agcagaaggg gcagctgacc agtgtccact cctcatcctg actccaccct      1260
     cccactcctt ggatttctcc tggagcctcc agggcaggac cttggaggga ggaacaacga      1320
     gcagaaggcc ctggcgact                                                   1339
//


spacer
spacer