spacer

EBI Dbfetch

ID   BC111891; SV 1; linear; mRNA; STD; MUS; 3052 BP.
XX
AC   BC111891;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus glutamate receptor, metabotropic 3, mRNA (cDNA clone
DE   MGC:132907 IMAGE:40061004), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3052
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3052
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JAN-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8c58fffb340a80078627ec2a260b0f80.
DR   Ensembl-Gn; ENSMUSG00000003974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004076; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 15 Row: m Column: 1.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3052
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:132907 IMAGE:40061004"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GAGGGTCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3052
FT                   /gene="Grm3"
FT                   /note="synonyms: Gprc1c, mGluR3"
FT   misc_difference 1..41
FT                   /gene="Grm3"
FT                   /note="41 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             183..2822
FT                   /codon_start=1
FT                   /gene="Grm3"
FT                   /product="glutamate receptor, metabotropic 3"
FT                   /db_xref="GOA:Q9QYS2"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001234"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYS2"
FT                   /protein_id="AAI11892.1"
FT                   /translation="MKMLTRLQVLMLALFSKGFLVSLGDHNFMRREIKIEGDLVLGGLF
FT                   PINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTY
FT                   ALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRL
FT                   FQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDY
FT                   GETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDS
FT                   RELIAAASRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSL
FT                   NPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQICDKHLAIDSSNYEQESKIMFVVNAVYA
FT                   MAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKGADSIVKFDT
FT                   YGDGMGRYNVFNFQHIGGKYSYLKVGHWAETLYLDVDSIHWSRNSVPTSQCSDPCAPNE
FT                   MKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIRWEDAW
FT                   AIGPVTIACLGFMCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAK
FT                   PSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLG
FT                   LILVQIVMVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTV
FT                   YAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGF
FT                   VVLGCLFAPKVHIVLFQPQKNVVTHRLHLNRFSVSGTATTYSQSSASTYVPTVCNGREV
FT                   LDSTTSSL"
FT   misc_difference 2084
FT                   /gene="Grm3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2946..2948
FT                   /gene="Grm3"
FT                   /note="3 bases in cDNA are not found in the mouse genome."
XX
SQ   Sequence 3052 BP; 803 A; 739 C; 713 G; 797 T; 0 other;
     cgcggtcagc ttcagttcct gccaggagtt gaccgtgcga ggaattcagt gacgggctct        60
     tttagcccta tcctccctta tctgaaggac agaccaaaga tcctacttgg aaatgagagg       120
     atactagcag gaaacattgg acccactcag tgatatctcc aagagataca gaaccaggat       180
     tcatgaagat gttgacaaga ctacaagttc ttatgttagc tttgttttca aagggatttt       240
     tagtctcttt aggagatcac aactttatga ggagagaaat taaaatagaa ggagaccttg       300
     ttttaggggg cttatttcct attaatgaaa aaggcactgg aactgaagag tgtggacgaa       360
     tcaatgaaga cagaggtatc caacgcctgg aggccatgtt gtttgccatt gatgaaatca       420
     acaaagacaa ttacttgctt ccaggagtga agctgggggt tcacattttg gatacatgtt       480
     caagagacac ctatgcatta gagcagtcac tggagtttgt cagagcatcg ttgactaaag       540
     tggatgaagc tgaatatatg tgtcctgatg gatcatatgc tattcaagaa aacatcccac       600
     tactcattgc aggagtcatt ggcggttcgt acagcagtgt ttccatacag gtggcaaacc       660
     tgctgaggct cttccagatc cctcagataa gctacgcctc caccagtgcc aaactcagcg       720
     acaaatcgcg ctatgattat tttgccagga ccgtgccccc tgacttctac caggccaaag       780
     ccatggccga gatcttgcgc tactttaact ggacctatgt gtccactgtt gcctctgaag       840
     gtgactatgg ggagacaggg attgaggcct tcgagcagga agcaaggcta cgcaacatct       900
     gcatcgccac tgctgaaaag gtggggcgct ccaacatccg caagtcctac gacagcgtga       960
     tccgtgagct cctgcagaaa cctaacgcgc gagttgtggt cctgttcatg cgcagtgatg      1020
     actcacgaga gttgatcgct gcagccagcc gcgtgaatgc ttccttcacc tgggtggcca      1080
     gcgatggctg gggtgcacag gagagcattg tcaagggcag tgagcacgtc gcctatggag      1140
     ccatcaccct ggagctggcg tcccaccctg ttcgtcagtt tgatcgctac ttccagagcc      1200
     tcaaccccta caacaatcat cgtaacccct ggttccgaga cttctgggag cagaagttcc      1260
     agtgcagcct ccagaacaag agaaaccaca gacagatttg tgacaagcac ctggccattg      1320
     acagcagcaa ctatgaacaa gaatccaaga tcatgtttgt ggtgaatgca gtgtatgcca      1380
     tggcgcatgc gctgcacaaa atgcaacgca ccctctgtcc caacaccacc aagctctgtg      1440
     atgcaatgaa gatcctggat ggaaagaagt tgtacaaaga ttatttgctg aaaatcaact      1500
     tcacagctcc attcaaccca aataaaggag cagacagcat tgtgaagttt gacacttacg      1560
     gagacgggat gggaagatac aacgtgttca acttccagca tataggtgga aagtattcct      1620
     acttaaaagt tggccactgg gcagaaactt tatatctaga tgtggactct attcattggt      1680
     cccggaactc agtccccact tcccagtgca gtgatccctg tgcccccaat gaaatgaaaa      1740
     acatgcagcc aggagatgtt tgctgctgga tctgcatccc atgtgagccc tatgaatacc      1800
     tggttgatga gttcacctgc atggattgtg gccctggcca gtggcccact gcagacctat      1860
     ctggatgcta caaccttcca gaggattaca tcaggtggga agatgcctgg gcaataggcc      1920
     cagtcactat tgcctgcctg ggttttatgt gtacatgcat agtcataact gtttttatca      1980
     agcacaacaa cacacccttg gtcaaagcat caggccgaga actctgctac atcttgttat      2040
     ttggagttag cctgtcctat tgcatgacat tcttcttcat tgccaagcca tcgcctgtca      2100
     tctgtgcatt gcgccgactt gggcttggga cctcctttgc catctgttat tcagctctcc      2160
     tgaccaagac aaactgcatc gctcgcatct ttgatggggt caagaatggc gctcagaggc      2220
     caaaattcat cagccccagt tctcaggttt ttatctgcct gggtttgata ctggtgcaaa      2280
     ttgtgatggt gtctgtgtgg cttatcttgg agactccagg tactagaaga tacaccctgc      2340
     cagagaagcg ggaaacagtc atcctaaaat gcaatgtcaa agattccagc atgttgatct      2400
     ctctgaccta tgacgtggtt ctggtgattc tatgcactgt gtatgccttc aaaacaagga      2460
     agtgtcctga aaacttcaat gaagccaagt tcataggctt caccatgtac accacctgca      2520
     tcatctggtt ggcattcctc cctatatttt atgtgacatc aagtgactac agagtgcaga      2580
     cgacaacaat gtgcatctcc gttagcttga gtggtttcgt ggtcttgggc tgtttgtttg      2640
     cccccaaggt gcacattgtc ctgttccaac cccagaagaa tgtggtcaca cacagacttc      2700
     acctcaacag gttcagtgtc agtggaactg cgaccacata ttctcagtcc tctgcaagca      2760
     catatgtccc gacagtgtgc aacggaaggg aagtcctgga ctccaccacc tcatctctgt      2820
     gattgtgact cgcagttcag ttctgtttat aggctgttag acgaagtgct cacatgctgc      2880
     tccagaatat ggaaacagaa caaaaacaac aaccctagta ccttcttttt tttttttttt      2940
     ttttttttag aaacagtaaa ataaattatt tttgaggact gtatggtata tagtgatgtg      3000
     ctacaacttt ctaggctgat tttagtgccc ctattaacag cccctcccca gg              3052
//


spacer
spacer