spacer

EBI Dbfetch

ID   BC111861; SV 1; linear; mRNA; STD; MUS; 1081 BP.
XX
AC   BC111861;
XX
DT   22-JAN-2006 (Rel. 86, Created)
DT   22-JAN-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Mus musculus G protein-coupled receptor 6, mRNA (cDNA clone
DE   IMAGE:40044903), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1081
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1081
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JAN-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 33357f382b8f46c9fad98cacde359442.
DR   Ensembl-Gn; ENSMUSG00000046922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061796; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 15 Row: c Column: 13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1081
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="IMAGE:40044903"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: AGAAG"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1081
FT                   /gene="Gpr6"
FT   CDS             <1..1081
FT                   /codon_start=2
FT                   /gene="Gpr6"
FT                   /product="Gpr6 protein"
FT                   /db_xref="GOA:Q2M2N8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR001151"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2155249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M2N8"
FT                   /protein_id="AAI11862.1"
FT                   /translation="AAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAALGGGG
FT                   GPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPM
FT                   FVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDR
FT                   YLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRPLTRS
FT                   HVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVV
FT                   LGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLL
FT                   FCGCFQSKVPFRSRSPSEV"
XX
SQ   Sequence 1081 BP; 163 A; 347 C; 322 G; 249 T; 0 other;
     cgccgccgcg ctcaacgagt cccaagtggt ggcagtagcg gccgagggag cggcagctgc        60
     ggctacagca gcaggggcac cggacaccgg cgaatgggga cccccagcag catccgcagc       120
     gctgggaggc ggcggcggac ctaacgggtc actggagctg tcttctcagc tgccagcagg       180
     gccctcggga ctactgcttt cggcagtgaa tccctgggat gtgctgctgt gcgtgtcggg       240
     aactgtgatc gcaggcgaaa atgcgctggt ggtggcgctc atcgcgtcca ctcccgcgct       300
     gcgcacgccc atgtttgtgc tcgtgggtag tctggccact gctgacctgt tggcgggctg       360
     tggcctcatc ttacacttcg tgttccagta cgtggtgccc tcggagactg tgagcctgct       420
     catggtgggc ttcctggtgg cgtcctttgc cgcctcagtc agcagcctgc ttgctatcac       480
     agttgaccgt tacctgtctt tgtacaacgc gctcacctac tactcgcgcc ggaccctgtt       540
     gggcgtgcac ctcttgctag cagccacctg gacagtgtcc ctcgggttgg ggttgctgcc       600
     tgttctaggc tggaactgct tggccgaccg cacgtcctgc agcgtggtgc gccccctgac       660
     acgcagccat gtggcgttgc tctctacttc cttcttcgtg gtctttggca tcatgctgca       720
     cttgtacgtg cgcatctgcc aggtggtctg gcgccacgcc caccagatcg ctttgcaaca       780
     gcattgccta gcaccgcccc acttagcagc caccagaaag ggagtgggaa ctttggccgt       840
     ggtgctaggc acttttgggg ccagctggct gcccttcgcc atctattgtg tggtgggtag       900
     ccaagaggac ccggccatct acacttatgc caccctgttg cctgccacct ataactccat       960
     gatcaatccc atcatctatg ccttccgcaa ccaggagatc cagcgtgcct tgtggctcct      1020
     gttctgtggc tgtttccaat ccaaagtgcc cttccgctcc aggtccccca gtgaggtctg      1080
     a                                                                      1081
//


spacer
spacer