spacer

EBI Dbfetch

ID   BC109178; SV 1; linear; mRNA; STD; MUS; 666 BP.
XX
AC   BC109178;
XX
DT   05-NOV-2005 (Rel. 85, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus regulator of G-protein signalling 10, mRNA (cDNA clone
DE   MGC:129414 IMAGE:40049527), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-666
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-666
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6cdc097fb6ec36af2067a2eeea1f0d54.
DR   Ensembl-Gn; ENSMUSG00000030844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033133; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 11 Row: l Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..666
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:129414 IMAGE:40049527"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: TATTCCA sequenced from the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..666
FT                   /gene="Rgs10"
FT   misc_feature    1..666
FT                   /gene="Rgs10"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS             44..589
FT                   /codon_start=1
FT                   /gene="Rgs10"
FT                   /product="regulator of G-protein signalling 10"
FT                   /db_xref="GOA:Q32MD7"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1915115"
FT                   /db_xref="UniProtKB/TrEMBL:Q32MD7"
FT                   /protein_id="AAI09179.1"
FT                   /translation="MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENL
FT                   LEDPEGVQRFREFLKKEFSEENVLFWLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASS
FT                   QVNVEGQSRLTEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKPKRTEEEEE
FT                   EPPDAQTAAKRASRIYNT"
XX
SQ   Sequence 666 BP; 176 A; 172 C; 187 G; 131 T; 0 other;
     cgccgcgctg cccggctgct ccgtcctctg gacgcccgcg gcgatgttca cccgcgccgt        60
     gagccgactg agcaggaagc ggccgccgtc tgatatccat gacggagatg ggagctcaag       120
     cagcggccac cagagcctta agagcacagc caagtgggca tcctccctgg agaatcttct       180
     ggaagaccca gaaggggtgc agagattcag ggagtttctg aagaaggaat tcagcgaaga       240
     gaatgtcttg ttttggctag cgtgtgaaga tttcaagaaa acggaggaca ggaagcagat       300
     gcaggaaaag gccaaggaga tctacatgac cttcctgtcc aataaggcct cttcacaagt       360
     caacgtggag gggcagtctc ggctcactga aaagattctg gaagagccac accctctgat       420
     gttccaaaag ctccaggacc agatcttcaa tctcatgaag tatgacagct acagccgctt       480
     cttgaagtct gacttgtttc tgaaacccaa gcgaactgag gaagaggaag aagagccccc       540
     ggatgctcag accgcagcta agcgagcctc cagaatttac aacacataag ctgagccctt       600
     caccccagcg aaggagaggg atggactctt aggactgtac aggctgtcat ttctttgttg       660
     tgtttg                                                                  666
//


spacer
spacer