spacer

EBI Dbfetch

ID   BC108922; SV 1; linear; mRNA; STD; HUM; 1119 BP.
XX
AC   BC108922;
XX
DT   05-NOV-2005 (Rel. 85, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens major histocompatibility complex, class II, DR beta 1, mRNA
DE   (cDNA clone MGC:120245 IMAGE:40023604), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1119
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1119
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 13 Row: e Column: 11.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1119
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_283"
FT                   /clone="MGC:120245 IMAGE:40023604"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: NA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1119
FT                   /gene="HLA-DRB1"
FT                   /note="synonyms: DRB1, HLA DRB1"
FT   CDS             56..856
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="HLA-DRB1 protein"
FT                   /db_xref="GOA:P01911"
FT                   /db_xref="H-InvDB:HIT000339178.10"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1BX2"
FT                   /db_xref="PDB:1YMM"
FT                   /db_xref="PDB:2WBJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01911"
FT                   /protein_id="AAI08923.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAV
FT                   DTYCRHNYGVGESFAVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   misc_difference 399..400
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : TG. The chimpanzee genome
FT                   agrees with the cDNA sequence, suggesting that this
FT                   difference is unlikely to be due to an artifact."
FT   misc_difference 410
FT                   /gene="HLA-DRB1"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'A' in cDNA, 'T' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 981
FT                   /gene="HLA-DRB1"
FT                   /note="'A' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1026..1027
FT                   /gene="HLA-DRB1"
FT                   /note="in the human genome : CC. The chimpanzee genome
FT                   agrees with the human genomic sequence and not the cDNA."
FT   misc_difference 1040
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'T' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1043
FT                   /gene="HLA-DRB1"
FT                   /note="1 base in cDNA is not found in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1048
FT                   /gene="HLA-DRB1"
FT                   /note="'T' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1099
FT                   /gene="HLA-DRB1"
FT                   /note="'C' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
XX
SQ   Sequence 1119 BP; 228 A; 306 C; 328 G; 257 T; 0 other;
     ccctgagtga gacttgcctg cttctctggc ccctggtcct gtcctgttct ccagcatggt        60
     gtgtctgaag ctccctggag gctcctgcat gacagcgctg acagtgacac tgatggtgct       120
     gagctcccca ctggctttgt ctggggacac ccgaccacgt ttcctgtggc agcctaagag       180
     ggagtgtcat ttcttcaatg ggacggagcg ggtgcggttc ctggacagat acttctataa       240
     ccaggaggag tccgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct       300
     ggggcggcct gacgctgagt actggaacag ccagaaggac atcctggagc aggcgcgggc       360
     cgcggtggac acctactgca gacacaacta cggggttggt gagagcttcg cagtgcagcg       420
     gcgagtccaa cctaaggtga ctgtatatcc ttcaaagacc cagcccctgc agcaccacaa       480
     cctcctggtc tgctctgtga gtggtttcta tccaggcagc attgaagtca ggtggttcct       540
     gaacggccag gaagagaagg ctgggatggt gtccacaggc ctgatccaga atggagactg       600
     gaccttccag accctggtga tgctggaaac agttcctcga agtggagagg tttacacctg       660
     ccaagtggag cacccaagcg tgacaagccc tctcacagtg gaatggagag cacggtctga       720
     atctgcacag agcaagatgc tgagtggagt cgggggcttt gtgctgggcc tgctcttcct       780
     tggggccggg ctgttcatct acttcaggaa tcagaaagga cactctggac ttcagccaac       840
     aggattcctg agctgaaatg cagatgacca cattcaagga agaactttct gccccggctt       900
     tgcaggatga aaagctttcc tgcttggcag ttattcttcc acaagagagg gctttctcag       960
     gacctggttg ctactggttc agcaactgca gaaaatgtcc tcccttgtgg cttcctcagc      1020
     tcctgttctt ggcctgaagc ccacagcttt gatggcagcg cctcatcttc aacttttgtg      1080
     ctcccctttg cctaaaccct atggcctccc gtgcatctg                             1119
//


spacer
spacer