spacer

EBI Dbfetch

ID   BC108275; SV 1; linear; mRNA; STD; HUM; 1736 BP.
XX
AC   BC108275;
XX
DT   05-NOV-2005 (Rel. 85, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens synuclein, alpha (non A4 component of amyloid precursor), mRNA
DE   (cDNA clone MGC:110988 IMAGE:6147966), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1736
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1736
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 968a8fd6e6b5d27d1f72e49726ad7cf5.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
DR   EuropePMC; PMC2851569; 20386743.
DR   EuropePMC; PMC3123060; 21518757.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC/DCTD/DTP
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 232 Row: e Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6806896.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1736
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_72"
FT                   /clone="MGC:110988 IMAGE:6147966"
FT                   /tissue_type="Skin, melanotic melanoma."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1736
FT                   /gene="SNCA"
FT                   /note="synonyms: PD1, NACP, PARK4"
FT   CDS             218..640
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="synuclein, alpha (non A4 component of amyloid
FT                   precursor)"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000339014.10"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="AAI08276.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
FT   misc_difference 1533
FT                   /gene="SNCA"
FT                   /note="'T' in cDNA is 'C' in the human genome."
FT   misc_difference 1733..1736
FT                   /gene="SNCA"
FT                   /note="4 bases at the 3' end do not align to the human
FT                   genome."
XX
SQ   Sequence 1736 BP; 519 A; 307 C; 401 G; 509 T; 0 other;
     ccagaagggg cccaagagag ggggcgagcg accgagcgcc gcgacgcgga agtgaggtgc        60
     gtgcgggctg cagcgcagac cccggcccgg cccctccgag agcgtcctgg gcgctccctc       120
     acgccttgcc ttcaagcctt ctgcctttcc accctcgtga gcggagaact gggagtggcc       180
     attcgacgac agtgtggtgt aaaggaattc attagccatg gatgtattca tgaaaggact       240
     ttcaaaggcc aaggagggag ttgtggctgc tgctgagaaa accaaacagg gtgtggcaga       300
     agcagcagga aagacaaaag agggtgttct ctatgtaggc tccaaaacca aggagggagt       360
     ggtgcatggt gtggcaacag tggctgagaa gaccaaagag caagtgacaa atgttggagg       420
     agcagtggtg acgggtgtga cagcagtagc ccagaagaca gtggagggag cagggagcat       480
     tgcagcagcc actggctttg tcaaaaagga ccagttgggc aagaatgaag aaggagcccc       540
     acaggaagga attctggaag atatgcctgt ggatcctgac aatgaggctt atgaaatgcc       600
     ttctgaggaa gggtatcaag actacgaacc tgaagcctaa gaaatatctt tgctcccagt       660
     ttcttgagat ctgctgacag atgttccatc ctgtacaagt gctcagttcc aatgtgccca       720
     gtcatgacat ttctcaaagt ttttacagtg tatctcgaag tcttccatca gcagtgattg       780
     aagtatctgt acctgccccc actcagcatt tcggtgcttc cctttcactg aagtgaatac       840
     atggtagcag ggtctttgtg tgctgtggat tttgtggctt caatctacga tgttaaaaca       900
     aattaaaaac acctaagtga ctaccactta tttctaaatc ctcactattt ttttgttgct       960
     gttgttcaga agttgttagt gatttgctat catatattat aagattttta ggtgtctttt      1020
     aatgatactg tctaagaata atgacgtatt gtgaaatttg ttaatatata taatacttaa      1080
     aaatatgtga gcatgaaact atgcacctat aaatactaaa tatgaaattt taccattttg      1140
     cgatgtgttt tattcacttg tgtttgtata taaatggtga gaattaaaat aaaacgttat      1200
     ctcattgcaa aaatatttta tttttatccc atctcacttt aataataaaa atcatgctta      1260
     taagcaacat gaattaagaa ctgacacaaa ggacaaaaat ataaagttat taatagccat      1320
     ttgaagaagg aggaatttta gaagaggtag agaaaatgga acattaaccc tacactcgga      1380
     attccctgaa gcaacactgc cagaagtgtg ttttggtatg cactggttcc ttaagtggct      1440
     gtgattaatt attgaaagtg gggtgttgaa gaccccaact actattgtag agtggtctat      1500
     ttctcccttc aatcctgtca atgtttgctt tatgtatttt ggggaactgt tgtttgatgt      1560
     gtatgtgttt ataattgtta tacattttta attgagcctt ttattaacat atattgttat      1620
     ttttgtctcg aaataatttt ttagttaaaa tctattttgt ctgatattgg tgtgaatgct      1680
     gtacctttct gacaataaat aatattcgac catgaataaa aaaaaaaaaa aaaaaa          1736
//


spacer
spacer