spacer

EBI Dbfetch

ID   BC107000; SV 1; linear; mRNA; STD; MUS; 1230 BP.
XX
AC   BC107000;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Mus musculus sphingosine-1-phosphate receptor 4, mRNA (cDNA clone
DE   MGC:129298 IMAGE:40045304), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1230
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1230
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 737ea4f9a6aa8148e98c2820e7792aaf.
DR   Ensembl-Gn; ENSMUSG00000044199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053646; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 11 Row: i Column: 23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:129298 IMAGE:40045304"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: AAATT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1230
FT                   /gene="S1pr4"
FT                   /note="synonyms: lpC1, S1P4"
FT   misc_feature    1..1230
FT                   /gene="S1pr4"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS             70..1230
FT                   /codon_start=1
FT                   /gene="S1pr4"
FT                   /product="sphingosine-1-phosphate receptor 4"
FT                   /db_xref="GOA:Q9Z0L1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR004061"
FT                   /db_xref="InterPro:IPR004064"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333809"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0L1"
FT                   /protein_id="AAI07001.1"
FT                   /translation="MNISTWSTLVTPESCHRLAASGHSLLIVLHYNHSGRLASRGGSED
FT                   GGGLGMLRGPSVAAGCLVVLENAMVLAAIAIYMRSRRWVYYCLLNITLSDLLTGLAYVV
FT                   NVLLSGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATMVRVAESGATKTSR
FT                   VYGCIGLCWLLAAILGLLPLLGWNCVCAFPRCSSLLPLYSKGYVLFCVVVFALILVAIL
FT                   SLYGAIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSN
FT                   VWAQEYLRGMDWILALAVFNSAINPLIYSFRSREVQRAVLAFLCCGCLWLGLRGPGDCL
FT                   TRITEAHSGASTTDSSLRPRDSFRTSRSLSFRMREPLSSISSVRST"
XX
SQ   Sequence 1230 BP; 178 A; 403 C; 374 G; 275 T; 0 other;
     caggaaaccc aggccaggca gtgactccac cctgcggagg cctctctcag tctgtccccg        60
     ggggaggcca tgaacatcag tacctggtcc acgctggtga ccccagagtc ctgccaccgg       120
     ctggcagcca gcggccacag cctcctcatt gtcctgcact acaatcacag cggcaggctg       180
     gccagccgcg ggggctctga ggacggtgga gggctaggga tgctgagggg gccgtcggtg       240
     gccgcaggtt gcctggtggt gctggagaac gccatggtgc tggccgccat cgccatctac       300
     atgcggtccc gccgctgggt gtactactgc ctgctgaaca tcacactgag tgacctgctc       360
     acaggcctgg cctacgtggt caacgtgctg ctgtcaggga ctcgtacctt ccagctgtca       420
     ccggtgcact ggttcctgcg ggagggcctg ctcttcatgg ccttggccgc atccaccttc       480
     agtctgctct tcacggccgg cgagcgcttc gccaccatgg tgcgggtggc tgagagtggg       540
     gccaccaaga ccagccgtgt gtatggctgc atcggtctgt gctggctact ggcagctatc       600
     ctgggcctgc tgcccctgct gggctggaac tgtgtgtgcg ccttcccacg ctgctccagc       660
     ctgctgcccc tctactccaa gggctatgtg ctcttttgtg tggtggtctt cgccctcatc       720
     ctagtggcta tcctgagcct ctacggggcc atctttagag tggtccgagc caatgggcag       780
     aagtctccac gtcctcctgc ccgccgcaag tcccgcaggc tactcaacac cgtgctgatg       840
     atcttggtgg cctttgtggt gtgctggggt cccctgtttg gcctgctcct ggctgacatc       900
     tttggttcta atgtctgggc ccaggagtac ctgcgtggca tggactggat cctggccctg       960
     gccgtgttca actcagccat taatcctctc atctactcct tccgcagccg tgaggtgcag      1020
     cgcgctgtgc tggccttcct gtgctgcggc tgtctctggc taggtctgcg aggtccagga      1080
     gactgcctga cccggatcac cgaggcccac tccggtgcat ccaccactga cagctccctg      1140
     aggcccaggg acagttttcg gacttctcgg tcactcagct tcaggatgag agagccgctg      1200
     tccagcattt ccagcgtccg cagcacctag                                       1230
//


spacer
spacer