spacer

EBI Dbfetch

ID   BC105669; SV 1; linear; mRNA; STD; MUS; 1172 BP.
XX
AC   BC105669;
XX
DT   09-AUG-2006 (Rel. 88, Created)
DT   09-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus chemokine (C-C motif) receptor 6, mRNA (cDNA clone MGC:124222
DE   IMAGE:40046795), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1172
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1172
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 9 Row: j Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1172
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:124222 IMAGE:40046795"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert"
FT                   /db_xref="taxon:10090"
FT   gene            1..1172
FT                   /gene="Ccr6"
FT   CDS             50..1153
FT                   /codon_start=1
FT                   /gene="Ccr6"
FT                   /product="Ccr6 protein"
FT                   /db_xref="GOA:Q542B6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q542B6"
FT                   /protein_id="AAI05670.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1172 BP; 280 A; 304 C; 281 G; 307 T; 0 other;
     tgggacttgc ttcctggcca ccgaggtgtg aacaacttca cagttctgaa tgaattccac        60
     agagtcctac tttggaacgg atgattatga caacacagag tattattcta ttcctccaga       120
     ccatgggcca tgctccctag aagaggtcag aaacttcacc aaggtatttg tgccaattgc       180
     ctactcctta atatgtgtct ttggcctcct gggcaacatt atggtggtga tgacctttgc       240
     cttctacaag aaagccagat ccatgactga cgtctacctg ttgaacatgg ccatcacaga       300
     catactcttt gtcctcaccc taccgttctg ggcagttact catgccacca acacttgggt       360
     tttcagcgat gcactgtgta aactgatgaa aggcacatat gcggtcaact ttaactgtgg       420
     gatgctgctc ctggcctgta tcagcatgga ccggtacatt gccatcgtcc aggcaaccaa       480
     atctttccgg gtacgctcca gaacactgac gcacagtaag gtcatctgtg tggcagtgtg       540
     gttcatctcc atcatcatct caagccctac atttatcttc aacaagaaat acgagctgca       600
     ggatcgtgat gtctgtgagc cacggtacag gtctgtctca gagcccatca cgtggaagct       660
     gctgggtatg ggactggagc tgttctttgg gttcttcacc cctttgctgt ttatggtgtt       720
     ctgctatctg ttcattatca agaccttggt gcaggcccag aactccaaga ggcacagagc       780
     catccgagtc gtgatcgctg tggttctcgt gttcctggct tgtcagatcc ctcacaacat       840
     ggtcctcctc gtgactgcgg tcaacacggg caaagtgggc cggagctgca gcaccgagaa       900
     agtcctcgcc tacaccagga acgtggccga ggtcctggct ttcctgcatt gctgcctcaa       960
     ccccgtgttg tatgcgttta ttggacagaa attcagaaac tacttcatga agatcatgaa      1020
     ggatgtgtgg tgtatgagaa ggaagaataa gatgcctggc ttcctctgtg cccgggttta      1080
     ctcggaaagc tacatctcca ggcagaccag tgagaccgtc gaaaatgata atgcatcgtc      1140
     ctttaccatg taacacgaga gcacaaagca ac                                    1172
//


spacer
spacer