spacer

EBI Dbfetch

ID   BC104489; SV 1; linear; mRNA; STD; MUS; 1692 BP.
XX
AC   BC104489;
XX
DT   15-SEP-2005 (Rel. 85, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus cytochrome P450, family 19, subfamily a, polypeptide 1, mRNA
DE   (cDNA clone MGC:124252 IMAGE:40047095), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1692
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1692
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 88b8ae48d7c0a115af5eed4f551e6267.
DR   Ensembl-Gn; ENSMUSG00000032274; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034811; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 9 Row: l Column: 10.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1692
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:124252 IMAGE:40047095"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: AATAATC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1692
FT                   /gene="Cyp19a1"
FT                   /note="synonyms: Ar, ArKO"
FT   CDS             25..1536
FT                   /codon_start=1
FT                   /gene="Cyp19a1"
FT                   /product="cytochrome P450, family 19, subfamily a,
FT                   polypeptide 1"
FT                   /db_xref="GOA:Q3ZAT3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAT3"
FT                   /protein_id="AAI04490.1"
FT                   /translation="MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESSS
FT                   SIPGPGYCLGIGPLISHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMF
FT                   HVMKHSHYISRFGSKRGLQCIGMHENGIIFNNNPSLWRTIRPFFMKALTGPGLVRMVEV
FT                   CVESIKQHLDRLGEVTDTSGYVDVLTLMRHIMLDTSNMLFLGIPLDESAIVKKIQGYFN
FT                   AWQALLIKPNIFFKISWLYRKYERSVKDLKDEIAVLVEKKRHKVSTAEKLEDCMDFATD
FT                   LIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYFMLLLVAEYPEVEAAILKEIHTVV
FT                   GDRDIKIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIG
FT                   RMHRLEYFPKPNEFTLENFEKNVPYRYFQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRF
FT                   QVKTLQKRCIENIPKKNDLSLHPNEDRHLVEIIFSPRNSDKYLQQ"
FT   misc_difference 1540
FT                   /gene="Cyp19a1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
XX
SQ   Sequence 1692 BP; 461 A; 378 C; 416 G; 437 T; 0 other;
     tcttctgagg ccaaatagcg caagatgttc ttggaaatgc tgaaccccat gcagtataat        60
     gtcaccatca tggtcccgga aactgtgact gtcagtgcca tgccactcct gctgatcatg       120
     ggcctccttc tcctgatttg gaattgtgag agctcgtctt caataccagg tcctggctac       180
     tgtctgggaa ttgggcccct catttcccat ggcagattct tgtggatggg gattggaagt       240
     gcctgcaact actacaataa gatgtatgga gagttcatga gagtctggat cagtggagag       300
     gagacactca ttatcagcaa gtcctcaagc atgttccatg tcatgaagca cagtcactac       360
     atctcccgat tcggcagcaa gcgtgggctg cagtgcatcg gcatgcatga gaacggcatc       420
     atatttaaca acaacccgag cctttggaga acaattcgcc ctttctttat gaaagctctg       480
     acgggccctg gtcttgttcg aatggtggaa gtttgtgtgg agtccatcaa gcagcatttg       540
     gaccggctgg gcgaagtcac cgacacctcg ggctacgtgg atgtgttgac cctcatgaga       600
     cacatcatgc tggacacctc taacatgctc ttcctgggga tccccctgga cgaaagtgct       660
     attgtgaaga aaatccaggg ttactttaac gcctggcaag ctctcctcat caaaccaaac       720
     atcttcttta agatttcttg gctctacaga aagtatgaac gatccgtcaa ggacttgaaa       780
     gacgagatag ctgttttggt ggaaaagaag agacacaaag tttccacagc tgagaaactg       840
     gaagactgta tggattttgc aactgatttg attttcgctg agagacgtgg agacctgacg       900
     aaagagaacg tgaatcagtg catactggag atgctgattg cagcccctga caccatgtcg       960
     gtcactctgt acttcatgtt acttctcgtc gcagagtatc cagaggtcga agcagcaatc      1020
     ctgaaggaga tccacactgt tgtgggtgac agagacataa agatcgagga tatccaaaat      1080
     ttaaaagtgg tggaaaactt cattaatgaa agcatgcggt accagcctgt tgtggacttg      1140
     gtcatgcgca gagctctgga ggatgacgta attgacggct acccggttaa aaagggaact      1200
     aacatcattc tgaacatcgg aagaatgcac aggctcgagt acttccctaa gcccaatgaa      1260
     tttacccttg aaaactttga gaagaatgtt ccctacaggt actttcagcc ttttggcttt      1320
     gggccccgcg gctgtgctgg gaagtacatc gccatggtga tgatgaaagt tgtcttggtt      1380
     acacttttga gacgattcca ggtgaagaca ctgcaaaaaa ggtgtattga aaacataccg      1440
     aaaaagaatg acctgtcctt gcacccaaat gaggacaggc accttgtgga aataattttc      1500
     tctccaagga attcagacaa gtacctccaa cagtgaagag gtgtggccta tctactctgg      1560
     ggcattactt atccgtaatt acatggaaac catccatttt atcgagtagg tggcgtgaac      1620
     ctcaccatga acatttgatg gtctgtagaa ttttatgatc atagctccta tggtttgtca      1680
     tcaagctggg ca                                                          1692
//


spacer
spacer