spacer

EBI Dbfetch

ID   BC100989; SV 1; linear; mRNA; STD; HUM; 1593 BP.
XX
AC   BC100989;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens RAR-related orphan receptor A, mRNA (cDNA clone MGC:119328
DE   IMAGE:40005786), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1593
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1593
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d44a3fd444a58c896998c03f47ea45bb.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000309157; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
DR   Ensembl-Tr; ENST00000449337; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 5 Row: h Column: 9.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1593
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_282"
FT                   /clone="MGC:119328 IMAGE:40005786"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: AATCAAAC sequenced from the reverse primer"
FT                   /db_xref="taxon:9606"
FT   gene            1..1593
FT                   /gene="RORA"
FT                   /note="synonyms: NR1F1, ROR1, ROR2, ROR3, RZRA"
FT   CDS             42..1448
FT                   /codon_start=1
FT                   /gene="RORA"
FT                   /product="RAR-related orphan receptor A"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000336401.10"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="AAI00990.1"
FT                   /translation="MMYFVIAAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS
FT                   QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAE
FT                   VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAV
FT                   SSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLA
FT                   QNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVE
FT                   FAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLG
FT                   CEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQ
FT                   HVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTS
FT                   EFEPAMQIDG"
FT   misc_difference 1304
FT                   /gene="RORA"
FT                   /note="'A' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
XX
SQ   Sequence 1593 BP; 493 A; 362 C; 354 G; 384 T; 0 other;
     ggaccatccg ctctccctgc gctctccgca ccgcggctta aatgatgtat tttgtgatcg        60
     cagcgatgaa agctcaaatt gaaattattc catgcaagat ctgtggagac aaatcatcag       120
     gaatccatta tggtgtcatt acatgtgaag gctgcaaggg ctttttcagg agaagtcagc       180
     aaagcaatgc cacctactcc tgtcctcgtc agaagaactg tttgattgat cgaaccagta       240
     gaaaccgctg ccaacactgt cgattacaga aatgccttgc cgtagggatg tctcgagatg       300
     ctgtaaaatt tggccgaatg tcaaaaaagc agagagacag cttgtatgca gaagtacaga       360
     aacaccggat gcagcagcag cagcgcgacc accagcagca gcctggagag gctgagccgc       420
     tgacgcccac ctacaacatc tcggccaacg ggctgacgga acttcacgac gacctcagta       480
     actacattga cgggcacacc cctgagggga gtaaggcaga ctccgccgtc agcagcttct       540
     acctggacat acagccttcc ccagaccagt caggtcttga tatcaatgga atcaaaccag       600
     aaccaatatg tgactacaca ccagcatcag gcttctttcc ctactgttcg ttcaccaacg       660
     gcgagacttc cccaactgtg tccatggcag aattagaaca ccttgcacag aatatatcta       720
     aatcgcatct ggaaacctgc caatacttga gagaagagct ccagcagata acgtggcaga       780
     cctttttaca ggaagaaatt gagaactatc aaaacaagca gcgggaggtg atgtggcaat       840
     tgtgtgccat caaaattaca gaagctatac agtatgtggt ggagtttgcc aaacgcattg       900
     atggatttat ggaactgtgt caaaatgatc aaattgtgct tctaaaagca ggttctctag       960
     aggtggtgtt tatcagaatg tgccgtgcct ttgactctca gaacaacacc gtgtactttg      1020
     atgggaagta tgccagcccc gacgtcttca aatccttagg ttgtgaagac tttattagct      1080
     ttgtgtttga atttggaaag agtttatgtt ctatgcacct gactgaagat gaaattgcat      1140
     tattttctgc atttgtactg atgtcagcag atcgctcatg gctgcaagaa aaggtaaaaa      1200
     ttgaaaaact gcaacagaaa attcagctag ctcttcaaca cgtcctacag aagaatcacc      1260
     gagaagatgg aatactaaca aagttaatat gcaaggtgtc tacattaaga gccttatgtg      1320
     gacgacatac agaaaagcta atggcattta aagcaatata cccagacatt gtgcgacttc      1380
     attttcctcc attatacaag gagttgttca cttcagaatt tgagccagca atgcaaattg      1440
     atgggtaaat gttatcacct aagcacttct agaatgtctg aagtacaaac atgaaaaaca      1500
     aacaaaaaaa ttaaccgaga cactttatat ggccctgcac agacctggag cgccacacac      1560
     tgcacatctt ttggtgatcg gggtcaggca aag                                   1593
//


spacer
spacer