spacer

EBI Dbfetch

ID   BC100758; SV 1; linear; mRNA; STD; MUS; 1270 BP.
XX
AC   BC100758;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus chemokine (C-C motif) receptor 6, mRNA (cDNA clone MGC:124221
DE   IMAGE:40046794), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1270
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1270
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 38d07ab8861d3b2c5f9d0744b85a28e8.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 9 Row: j Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1270
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:124221 IMAGE:40046794"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: AAAAGTCC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1270
FT                   /gene="Ccr6"
FT   CDS             144..1247
FT                   /codon_start=1
FT                   /gene="Ccr6"
FT                   /product="Ccr6 protein"
FT                   /db_xref="GOA:Q542B6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q542B6"
FT                   /protein_id="AAI00759.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1270 BP; 302 A; 328 C; 306 G; 334 T; 0 other;
     tcctgggact tgcttcctgg ccaccgaggt gtgaacaact tcacagttct aatagtcctc        60
     acattcttag gactggagcc tggataacca ctgaggcagg agtacctggc cagtctactt       120
     tggagctcag cattttctgg ggaatgaatt ccacagagtc ctactttgga acggatgatt       180
     atgacaacac agagtattat tctattcctc cagaccatgg gccatgctcc ctagaagagg       240
     tcagaaactt caccaaggta tttgtgccaa ttgcctactc cttaatatgt gtctttggcc       300
     tcctgggcaa cattatggtg gtgatgacct ttgccttcta caagaaagcc agatccatga       360
     ctgacgtcta cctgttgaac atggccatca cagacatact ctttgtcctc accctaccgt       420
     tctgggcagt tactcatgcc accaacactt gggttttcag cgatgcactg tgtaaactga       480
     tgaaaggcac atatgcggtc aactttaact gtgggatgct gctcctggcc tgtatcagca       540
     tggaccggta cattgccatc gtccaggcaa ccaaatcttt ccgggtacgc tccagaacac       600
     tgacgcacag taaggtcatc tgtgtggcag tgtggttcat ctccatcatc atctcaagcc       660
     ctacatttat cttcaacaag aaatacgagc tgcaggatcg tgatgtctgt gagccacggt       720
     acaggtctgt ctcagagccc atcacgtgga agctgctggg tatgggactg gagctgttct       780
     ttgggttctt cacccctttg ctgtttatgg tgttctgcta tctgttcatt atcaagacct       840
     tggtgcaggc ccagaactcc aagaggcaca gagccatccg agtcgtgatc gctgtggttc       900
     tcgtgttcct ggcttgtcag atccctcaca acatggtcct cctcgtgact gcggtcaaca       960
     cgggcaaagt gggccggagc tgcagcaccg agaaagtcct cgcctacacc aggaacgtgg      1020
     ccgaggtcct ggctttcctg cattgctgcc tcaaccccgt gttgtatgcg tttattggac      1080
     agaaattcag aaactacttc atgaagatca tgaaggatgt gtggtgtatg agaaggaaga      1140
     ataagatgcc tggcttcctc tgtgcccggg tttactcgga aagctacatc tccaggcaga      1200
     ccagtgagac cgtcgaaaat gataatgcat cgtcctttac catgtaacac gagagcacaa      1260
     agcaacattg                                                             1270
//


spacer
spacer