spacer

EBI Dbfetch

ID   BC100757; SV 1; linear; mRNA; STD; MUS; 1294 BP.
XX
AC   BC100757;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus chemokine (C-C motif) receptor 6, mRNA (cDNA clone MGC:124223
DE   IMAGE:40046796), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1294
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1294
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 43d139644f742634779f66afe45f17ca.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 9 Row: j Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1294
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:124223 IMAGE:40046796"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TATGAG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1294
FT                   /gene="Ccr6"
FT   CDS             168..1271
FT                   /codon_start=1
FT                   /gene="Ccr6"
FT                   /product="Ccr6 protein"
FT                   /db_xref="GOA:Q542B6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q542B6"
FT                   /protein_id="AAI00758.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1294 BP; 304 A; 349 C; 303 G; 338 T; 0 other;
     tcctgggact tgcttcctgg ccaccgaggt gtgaacaact tcacagttct cttcacctct        60
     gctctcccaa catctgcact agtgagagtg tggctgaact gcccacttcc ctttctacac       120
     cagatctggc tctcccatcc acatagagaa ccacgcctgc ctggggaatg aattccacag       180
     agtcctactt tggaacggat gattatgaca acacagagta ttattctatt cctccagacc       240
     atgggccatg ctccctagaa gaggtcagaa acttcaccaa ggtatttgtg ccaattgcct       300
     actccttaat atgtgtcttt ggcctcctgg gcaacattat ggtggtgatg acctttgcct       360
     tctacaagaa agccagatcc atgactgacg tctacctgtt gaacatggcc atcacagaca       420
     tactctttgt cctcacccta ccgttctggg cagttactca tgccaccaac acttgggttt       480
     tcagcgatgc actgtgtaaa ctgatgaaag gcacatatgc ggtcaacttt aactgtggga       540
     tgctgctcct ggcctgtatc agcatggacc ggtacattgc catcgtccag gcaaccaaat       600
     ctttccgggt acgctccaga acactgacgc acagtaaggt catctgtgtg gcagtgtggt       660
     tcatctccat catcatctca agccctacat ttatcttcaa caagaaatac gagctgcagg       720
     atcgtgatgt ctgtgagcca cggtacaggt ctgtctcaga gcccatcacg tggaagctgc       780
     tgggtatggg actggagctg ttctttgggt tcttcacccc tttgctgttt atggtgttct       840
     gctatctgtt cattatcaag accttggtgc aggcccagaa ctccaagagg cacagagcca       900
     tccgagtcgt gatcgctgtg gttctcgtgt tcctggcttg tcagatccct cacaacatgg       960
     tcctcctcgt gactgcggtc aacacgggca aagtgggccg gagctgcagc accgagaaag      1020
     tcctcgccta caccaggaac gtggccgagg tcctggcttt cctgcattgc tgcctcaacc      1080
     ccgtgttgta tgcgtttatt ggacagaaat tcagaaacta cttcatgaag atcatgaagg      1140
     atgtgtggtg tatgagaagg aagaataaga tgcctggctt cctctgtgcc cgggtttact      1200
     cggaaagcta catctccagg cagaccagtg agaccgtcga aaatgataat gcatcgtcct      1260
     ttaccatgta acacgagagc acaaagcaac attg                                  1294
//


spacer
spacer