spacer

EBI Dbfetch

ID   BC100756; SV 1; linear; mRNA; STD; MUS; 1385 BP.
XX
AC   BC100756;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus chemokine (C-C motif) receptor 6, mRNA (cDNA clone MGC:124224
DE   IMAGE:40046797), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1385
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1385
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b113c727c8f7a8bcb99b6c8308c60312.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 9 Row: h Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1385
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:124224 IMAGE:40046797"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: ATAAATC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1385
FT                   /gene="Ccr6"
FT   CDS             259..1362
FT                   /codon_start=1
FT                   /gene="Ccr6"
FT                   /product="Ccr6 protein"
FT                   /db_xref="GOA:Q542B6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q542B6"
FT                   /protein_id="AAI00757.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1385 BP; 325 A; 371 C; 327 G; 362 T; 0 other;
     tcctgggact tgcttcctgg ccaccgaggt gtgaacaact tcacagttct aatagtcctc        60
     acattcttag gactggagcc tggataacca ctgaggcagg agtacctggc cagtctactt       120
     tggagctcag cattttctgg gcttcacctc tgctctccca acatctgcac tagtgagagt       180
     gtggctgaac tgcccacttc cctttctaca ccagatctgg ctctcccatc cacatagaga       240
     accacgcctg cctggggaat gaattccaca gagtcctact ttggaacgga tgattatgac       300
     aacacagagt attattctat tcctccagac catgggccat gctccctaga agaggtcaga       360
     aacttcacca aggtatttgt gccaattgcc tactccttaa tatgtgtctt tggcctcctg       420
     ggcaacatta tggtggtgat gacctttgcc ttctacaaga aagccagatc catgactgac       480
     gtctacctgt tgaacatggc catcacagac atactctttg tcctcaccct accgttctgg       540
     gcagttactc atgccaccaa cacttgggtt ttcagcgatg cactgtgtaa actgatgaaa       600
     ggcacatatg cggtcaactt taactgtggg atgctgctcc tggcctgtat cagcatggac       660
     cggtacattg ccatcgtcca ggcaaccaaa tctttccggg tacgctccag aacactgacg       720
     cacagtaagg tcatctgtgt ggcagtgtgg ttcatctcca tcatcatctc aagccctaca       780
     tttatcttca acaagaaata cgagctgcag gatcgtgatg tctgtgagcc acggtacagg       840
     tctgtctcag agcccatcac gtggaagctg ctgggtatgg gactggagct gttctttggg       900
     ttcttcaccc ctttgctgtt tatggtgttc tgctatctgt tcattatcaa gaccttggtg       960
     caggcccaga actccaagag gcacagagcc atccgagtcg tgatcgctgt ggttctcgtg      1020
     ttcctggctt gtcagatccc tcacaacatg gtcctcctcg tgactgcggt caacacgggc      1080
     aaagtgggcc ggagctgcag caccgagaaa gtcctcgcct acaccaggaa cgtggccgag      1140
     gtcctggctt tcctgcattg ctgcctcaac cccgtgttgt atgcgtttat tggacagaaa      1200
     ttcagaaact acttcatgaa gatcatgaag gatgtgtggt gtatgagaag gaagaataag      1260
     atgcctggct tcctctgtgc ccgggtttac tcggaaagct acatctccag gcagaccagt      1320
     gagaccgtcg aaaatgataa tgcatcgtcc tttaccatgt aacacgagag cacaaagcaa      1380
     cattg                                                                  1385
//


spacer
spacer