spacer

EBI Dbfetch

ID   BC100718; SV 1; linear; mRNA; STD; MUS; 1128 BP.
XX
AC   BC100718;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus kallikrein related-peptidase 4 (prostase, enamel matrix,
DE   prostate), mRNA (cDNA clone MGC:123983 IMAGE:40045065), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1128
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1128
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 30876af66ffc8b19354cc5c321352f07.
DR   Ensembl-Gn; ENSMUSG00000006948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007161; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 9 Row: b Column: 5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1128
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:123983 IMAGE:40045065"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: ATAGGACG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1128
FT                   /gene="Klk4"
FT                   /note="synonyms: PSTS, ESMP1, KLK-L1"
FT   misc_feature    1..1128
FT                   /gene="Klk4"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS             24..791
FT                   /codon_start=1
FT                   /gene="Klk4"
FT                   /product="kallikrein related-peptidase 4 (prostase, enamel
FT                   matrix, prostate)"
FT                   /db_xref="GOA:Q9Z0M1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="MGI:MGI:1861379"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0M1"
FT                   /protein_id="AAI00719.1"
FT                   /translation="MMVTARTPWGWFLGCLILEVTGASASSVSSRIIQGQDCSPHSQPW
FT                   QAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVGLGLHNLKGSQEPGSRMLEAHLSI
FT                   QHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWGQLKNGKLP
FT                   SLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLV
FT                   SMGQGKCGQPGIPSVYTNLCKFTNWIQTIIQTN"
XX
SQ   Sequence 1128 BP; 264 A; 351 C; 267 G; 246 T; 0 other;
     gcccagaagc agcaggagcc aacatgatgg tcactgcacg aaccccctgg ggctggttcc        60
     tggggtgcct catccttgag gtcacaggag cctccgcctc aagtgtcagc agccggatca       120
     tacaaggcca ggactgctcc ccacactcgc aaccctggca ggcggcactg ttctcagaag       180
     acggtttttt ctgctcggga gtcttggtgc atccgcagtg ggtgctgtca gcagcacatt       240
     gcttacagga gtcctacatc gtgggactgg gcctgcataa cctgaaaggc tcccaagagc       300
     ctggcagccg gatgttagag gcccacctct ccatccagca ccccaacttc aacgatcctt       360
     cttttgcaaa cgatctcatg ctcatcaaac tgaacgagtc agtgatagag tctaacacta       420
     tcaggagcat ccctgtggct acccaatgcc ccactcctgg agatacctgc ctagtctctg       480
     gttggggtca actaaagaat gggaaactgc ccagcctcct gcagtgtgtg aatctctcag       540
     tggcgtcaga ggagacttgc cggctgctgt atgaccctgt gtaccacctc agtatgttct       600
     gcgctggagg aggacaggac caaaaggact cctgcaatgg ggactctggg ggtcccatag       660
     tgtgcaacag atccctacaa gggctcgtgt ctatgggaca aggaaagtgt gggcagcctg       720
     gcataccaag tgtctacacc aatctctgca agttcactaa ctggatccag accatcattc       780
     agacaaacta gctatggact gactacaagg cccacatgaa gcctgctgag ggaacctgag       840
     actcaggatt gctcctagcc cttctccctc agatctacaa ggtcaggccc tagcctcctc       900
     cctcagactc acaagtccag actccaatct cctccctcag acccacaagt ccagactcca       960
     atttcctctc tcagatccaa ggattcagac cacaataccc tctttcagat tcagggatcc      1020
     atgccacaac ctcctccctg gaacacagga gtggaaccca cctgcatttt cctctgtgtg      1080
     cagtgtcctc tagtagccca gtattgaccc agccttgcct ttgtcacc                   1128
//


spacer
spacer