spacer

EBI Dbfetch

ID   BC099968; SV 1; linear; mRNA; STD; MUS; 3885 BP.
XX
AC   BC099968;
XX
DT   31-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus guanylate cyclase 2c, mRNA (cDNA clone MGC:107510
DE   IMAGE:6432585), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3885
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3885
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-JUL-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8a5da3d15f431f96a1c2314f0fe03cc8.
DR   Ensembl-Gn; ENSMUSG00000042638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078095; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gerard Gradwohl (PNAS 97 P1607-1611, 2000)
CC   cDNA Library Preparation: Catherine Lee, Endocrine Pancreas
CC   Consortium
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 207 Row: a Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3885
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_137"
FT                   /clone="MGC:107510 IMAGE:6432585"
FT                   /tissue_type="Pancreas, pooled libraries Melton normalized
FT                   mixed mouse pancreas 1 N1-MMS1, Amplified Melton mou se
FT                   islets 1 MIS1-A, and Kaestner ngn3 wt."
FT                   /note="Vector: pSPORT1"
FT                   /db_xref="taxon:10090"
FT   gene            1..3885
FT                   /gene="Gucy2c"
FT                   /note="synonyms: Gcc, GC-C"
FT   CDS             137..3283
FT                   /codon_start=1
FT                   /gene="Gucy2c"
FT                   /product="guanylate cyclase 2c"
FT                   /db_xref="GOA:Q3UWA6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:106903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UWA6"
FT                   /protein_id="AAH99968.1"
FT                   /translation="MTSLLGLAVRLLLFQPALMVFWASQVRQNCRNGSYEISVLMMDNS
FT                   AYKEPMQNLREAVEEGLDIVRKRLREADLNVTVNATFIYSDGLIHKSGDCRSSTCEGLD
FT                   LLREITRDHKMGCALMGPSCTYSTFQMYLDTELNYPMISAGSYGLSCDYKETLTRILPP
FT                   ARKLMYFLVDFWKVNNASFKPFSWNSSYVYKNGSEPEDCFWYLNALEAGVSYFSEVLNF
FT                   KDVLRRSEQFQEILTGHNRKSNVIVMCGTPESFYDVKGDLQVAEDTVVILVDLFSNHYF
FT                   EENTTAPEYMDNVLVLTLPSEQSTSNTSVAERFSSGRSDFSLAYLEGTLLFGHMLQTFL
FT                   ENGENVTGPKFARAFRNLTFQGFAGPVTLDDSGDIDNIMSLLYVSLDTRKYKVLMKYDT
FT                   HKNKTIPVAENPNFIWKNHKLPNDVPGLGPQILMIAVFTLTGILVVLLLIALLVLRKYR
FT                   RDHALRQKKWSHIPSENIFPLETNETNHISLKIDDDRRRDTIQRVRQCKYDKKLLQSDY
FT                   YNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDTISYPDGTFMDWEFKISVLNDIAKG
FT                   MSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQATISQ
FT                   KGDVYSFAIIAQEIILRKETFYTLSCRDHNEKIFRVENSYGKPFRPDLFLETADEKELE
FT                   VYLLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHL
FT                   VEERTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTIC
FT                   KYSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRHAVDISKM
FT                   ALDILSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMES
FT                   TGLPLRIHMSSSTIAILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQEYNLPSPP
FT                   TVENQQRLQTEFSDMIVSALQKRQASGKKSRRPTRVASYKKGFLEYMQLNNSDHDSTYF
FT                   "
FT   misc_difference 1327
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1492
FT                   /gene="Gucy2c"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1573
FT                   /gene="Gucy2c"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1678
FT                   /gene="Gucy2c"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1694
FT                   /gene="Gucy2c"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1699
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1990
FT                   /gene="Gucy2c"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2104
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2161
FT                   /gene="Gucy2c"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2194
FT                   /gene="Gucy2c"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2584
FT                   /gene="Gucy2c"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2839
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2969
FT                   /gene="Gucy2c"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'A' in cDNA, 'T' in the mouse genome."
FT   misc_difference 2992
FT                   /gene="Gucy2c"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3022
FT                   /gene="Gucy2c"
FT                   /note="'A' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3046
FT                   /gene="Gucy2c"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3124
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3220
FT                   /gene="Gucy2c"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3360
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3363
FT                   /gene="Gucy2c"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3369
FT                   /gene="Gucy2c"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3388
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3425..3427
FT                   /gene="Gucy2c"
FT                   /note="3 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3443..3445
FT                   /gene="Gucy2c"
FT                   /note="3 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3508
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3516
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3538
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3591
FT                   /gene="Gucy2c"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3637
FT                   /gene="Gucy2c"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 3653^3654
FT                   /gene="Gucy2c"
FT                   /note="1 base in the mouse genome, G, is not found in
FT                   cDNA."
FT   misc_difference 3696
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3790
FT                   /gene="Gucy2c"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3851
FT                   /gene="Gucy2c"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 3870..3885
FT                   /gene="Gucy2c"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3885 BP; 1020 A; 935 C; 1002 G; 928 T; 0 other;
     gaccagtgtg gcaagaccag aaaggtgcgt ggggaagaga agaccaaggg actctgctag        60
     cgactctcca gaggggctcc ctgtgtctct aaaagcgagc aatccagggg ggcatggtgc       120
     tacggtgagc caggtcatga cgtcactgct gggcttggct gtgcggttac tgctcttcca       180
     gcccgcgctg atggtgttct gggcctctca ggtgaggcag aactgccgca atggcagcta       240
     cgagatcagc gtcctgatga tggacaactc agcctacaaa gaacctatgc aaaacctgag       300
     ggaggctgtg gaggaaggac tggacatagt gcgaaagcgc ctgcgtgaag ccgacctaaa       360
     tgtgactgtg aacgcgactt tcatctactc cgacggtctg attcataagt caggtgactg       420
     ccggagcagc acctgtgaag gccttgacct actcagggag attacaagag atcataagat       480
     gggctgcgcc ctcatggggc cctcgtgcac gtattccacc ttccagatgt acctcgacac       540
     agagttgaac tatcccatga tttccgctgg aagttatgga ttgtcctgtg actataagga       600
     aaccctaacc aggatcctgc ctccagccag gaagctgatg tacttcttgg tcgatttctg       660
     gaaagtcaac aatgcatctt tcaaaccctt ttcctggaac tcttcgtatg tttacaagaa       720
     tggatcggaa cctgaagatt gtttctggta cctcaatgct ctggaggctg gggtgtccta       780
     tttttctgag gtgctcaact tcaaggatgt actgagacgc agcgaacagt tccaggaaat       840
     cttaacaggc cataacagaa agagcaatgt gattgttatg tgtggcacgc cagaaagctt       900
     ctatgatgtg aaaggtgacc tccaagtggc tgaagatact gttgtcatcc tggtagatct       960
     gttcagtaac cattactttg aggagaacac cacagctcct gagtatatgg acaatgtcct      1020
     cgtcctgacg ctgccgtctg aacagtccac ctcaaacacc tctgtcgccg agaggttttc      1080
     atcggggaga agtgactttt ctctcgctta cttggaggga accttgctat ttggacacat      1140
     gctgcagacg tttcttgaaa atggagaaaa tgtcacgggt cccaagtttg ctcgtgcatt      1200
     caggaatctc acttttcaag gctttgcagg acctgtgact ctggatgaca gtggggacat      1260
     tgacaacatt atgtcccttc tgtatgtgtc tctggatacc aggaaataca aggttcttat      1320
     gaagtacgac acccacaaaa acaaaactat tccggtggct gagaacccca acttcatctg      1380
     gaagaaccac aagctcccca atgacgttcc tgggctgggc cctcaaatcc tgatgattgc      1440
     cgtcttcacg ctcacgggga tcctggtagt tctgctgctg attgccctcc ttgtgctgag      1500
     aaaatacaga agagatcatg cacttcgaca gaagaaatgg tcccacattc cttctgaaaa      1560
     catctttcct ctagagacca acgagaccaa ccacatcagc ctgaagattg acgatgacag      1620
     gagacgagac acaatccaga gagtgcgaca gtgcaaatac gacaagaagt tgctgcaatc      1680
     tgactactac aacttgacca agttctacgg caccgtgaag ctggacacca ggatctttgg      1740
     ggtggttgag tactgcgaga ggggatccct ccgggaagtg ttaaacgaca caatttccta      1800
     ccctgacggc acgttcatgg attgggagtt taagatctct gtcttaaatg acatcgctaa      1860
     ggggatgtcc tacctgcact ccagtaagat tgaagtccac gggcgtctca aatccaccaa      1920
     ctgcgtggtg gacagccgca tggtggtgaa gatcaccgac tttgggtgca attccatcct      1980
     gcctccaaag aaagacctgt ggacggcccc ggagcacctg cgccaggcca ccatctctca      2040
     gaaaggagac gtgtacagct tcgccatcat tgcccaggag atcatcctcc gtaaggagac      2100
     tttctacacg ctgagctgtc gggatcacaa tgagaagatt ttcagagtgg aaaattcata      2160
     tgggaaacct ttccgcccag acctcttcct ggaaactgca gatgagaagg agctggaggt      2220
     ctatctactt gtcaaaagct gttgggagga ggatccagaa aagaggccag atttcaagaa      2280
     aatcgagagc acactggcca agatatttgg ccttttccat gaccagaaaa acgagtctta      2340
     catggacacc ttgatccgac gtctccagct gtactctcga aacctggaac atctggtgga      2400
     ggaaaggact cagctgtaca aggcggagag ggacagggct gaccacctta acttcatgct      2460
     cctcccacgg ctggtggtaa agtcactgaa ggagaaaggc atcgtggagc cagagctgta      2520
     cgaagaagtc acaatctact tcagtgacat tgtgggcttc accaccatct gcaagtatag      2580
     cacacccatg gaggtggtgg acatgctcaa cgacatctac aagagctttg accagattgt      2640
     ggaccaccat gacgtctaca aggtagaaac catcggtgac gcctacgtgg tggccagcgg      2700
     tctgcctatg agaaacggca accgacacgc ggtagacatt tccaagatgg ccttggacat      2760
     cctcagcttc atagggacct ttgagttgga gcatctccct ggcctccccg tgtggatccg      2820
     cattggagtt cattctggcc cctgcgctgc tggtgttgtg gggatcaaga tgcctcgcta      2880
     ttgcctgttt ggagacactg tcaacactgc ctccaggatg gaatccaccg gcctcccctt      2940
     gaggattcac atgagcagct ccaccatagc catcctgaag agaacggatt gtcagttcct      3000
     gtatgaagtg aggggagaaa catacttaaa gggaagaggg acagaaacca catactggct      3060
     gactgggatg aaggaccaag aatacaacct gccatcccca ccgacagtgg agaaccaaca      3120
     gcgcctgcag actgagttct cagacatgat cgttagcgcc ttacagaaaa gacaggcctc      3180
     gggcaagaag agccggaggc ccactcgggt ggccagctat aagaaaggct ttctggaata      3240
     catgcagctg aacaattcag accacgatag cacctatttt tagaccaagt gaggtctgag      3300
     aactgacagt agcaacctcc tatatcatga atctgtattt tccagagacc tcaacaacac      3360
     aggcaagcgc ttagcctcag tgccctgcct ggaacgtaga accaacccct caagtcatgt      3420
     gggtgttctg attttgggtt gggggttggt tggttggttg gttggttttg gttttgttga      3480
     gacagagttt cgtgtatccc aagctggcct caaacccact gtgtagcagc agatgacctt      3540
     ggacttctaa gatcatccgt gtgtgttcct gacagtgtga tgagtgtata ggtcagagcc      3600
     ctgtcccaca gttctccatg gagcatcaac ctgaattgag gagcgaggag gggaatgtcc      3660
     tgtgctgtac agaacttggg gttttgttct aatttcatct ctggtttggt tttgttttct      3720
     ggctccttcc ctctctatgt gtgagagaag tttttaaatt gtctgaattg tatgctaagt      3780
     agcttatctc caagaaagtg tgtttaacta gtgatttttg cagaaaccat gctggatatt      3840
     aggtaaaaaa ataaaagtgt ttagagtctg aaaaaaaaaa aaaaa                      3885
//


spacer
spacer