spacer

EBI Dbfetch

ID   BC098482; SV 1; linear; mRNA; STD; MUS; 1979 BP.
XX
AC   BC098482;
XX
DT   26-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus G protein-coupled receptor 37-like 1, mRNA (cDNA clone
DE   MGC:107437 IMAGE:30103328), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1979
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1979
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a48caf6297a74685961764fcc4cd9d9e.
DR   Ensembl-Gn; ENSMUSG00000026424; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027682; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Angelo L. Vescovi (Institute for Stem Cell
CC   Research, Italy)
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 207 Row: i Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 30794241.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1979
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="CD1"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse Neural Stem Cell (Differentiated)
FT                   cDNA Library (Long)"
FT                   /clone="MGC:107437 IMAGE:30103328"
FT                   /tissue_type="Neural Stem Cell, (Differentiated), adult
FT                   mouse"
FT                   /note="Vector: pSPORT1"
FT                   /db_xref="taxon:10090"
FT   gene            1..1979
FT                   /gene="Gpr37l1"
FT                   /note="synonym: CAG-18"
FT   misc_difference 222
FT                   /gene="Gpr37l1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   CDS             268..1314
FT                   /codon_start=1
FT                   /gene="Gpr37l1"
FT                   /product="G protein-coupled receptor 37-like 1"
FT                   /db_xref="GOA:A1L151"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1928503"
FT                   /db_xref="UniProtKB/TrEMBL:A1L151"
FT                   /protein_id="AAH98482.2"
FT                   /translation="MLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFL
FT                   VLFFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLP
FT                   KVRPIERCQSILAKLAVIWVGSMMLAVPELLLWQLAQEPAPTAGTVDSCIMKPSADLPE
FT                   SVYSLVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCES
FT                   QLNSTVVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPV
FT                   LLLCICRPLGQAFLDCCCCCCCEECGGASDSSATVSADSKLKAEVSSSIYFHKPRESPP
FT                   LLPLGTPC"
FT   misc_difference 327
FT                   /gene="Gpr37l1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 456
FT                   /gene="Gpr37l1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 504
FT                   /gene="Gpr37l1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 744
FT                   /gene="Gpr37l1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 759
FT                   /gene="Gpr37l1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1329
FT                   /gene="Gpr37l1"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1775
FT                   /gene="Gpr37l1"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1869
FT                   /gene="Gpr37l1"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1961..1979
FT                   /gene="Gpr37l1"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1979 BP; 395 A; 583 C; 511 G; 490 T; 0 other;
     cgaagaggca ccaaggacga ggggcccaag gaggtacagc actatgtacc cgaggagtgg        60
     gctgaatatc ccaagcccat ccatcctgct ggcctgcagc ccaccaagac tttggaggcc       120
     actagcccca acccagacaa ggatggggcc accccaggta atggacaaga gctgagggtc       180
     aacctgaccg ggacgccaag tcagaggctg cagattcaga atcccctgta tccggtgacc       240
     gagagctcct acagcgccta cgccatcatg ctcctggctc tggtggtgtt tgctgtgggt       300
     atcgttggca atctgtctgt catgtgtatt gtgtggcaca gctactactt gaagagtgcc       360
     tggaactcta tccttgccag cctggctctc tgggatttcc tggtcctctt cttctgcctc       420
     ccaattgtca tcttcaatga gattaccaag caaagactac tcggggatgt ttcttgccgg       480
     gcagtgccct tcatggaggt ctcttccctg ggagtcacaa ccttcagtct ctgtgccctg       540
     ggcatagacc gattccatgt ggccaccagc accctgccaa aggtgaggcc cattgagcga       600
     tgtcaatcaa ttctggctaa actagctgtc atctgggtgg gctccatgat gctggccgtg       660
     cccgaactcc tgctatggca gctggcccag gagccggctc ccaccgcagg aactgtggac       720
     tcgtgtatca tgaaaccttc agccgacctg cccgaatccg tctattcgct ggtgatgacc       780
     taccagaatg cccgcatgtg gtggtatttt ggttgctact tctgtctgcc catcctcttc       840
     accgtcacct gtcagctggt gacgtggcgg gtgcggggcc caccaggcag gaagcctgag       900
     tgtagagcgg gcaggcatga gcagtgtgag agccagctca acagcaccgt ggtcggcctg       960
     actgtggtct atgccttctg tacactccct gagaacgtct gcaatatcgt ggtggcttac      1020
     ctctctaccg agctcacgcg gcagaccctg gacctcctgg gcctcatcaa ccagttctcc      1080
     accttcttta agggcgccat cacccctgtg ctcctcctgt gcatctgcag gccactgggc      1140
     caggcctttc tggattgctg ctgctgctgc tgctgcgagg agtgcggcgg ggcctcagac      1200
     tcctcagcca cagtcagcgc ggacagcaag ctgaaggcgg aagtgtcctc ttctatctac      1260
     ttccacaagc ccagggagtc gcccccactc ctgcccctgg gcaccccttg ctgagtctat      1320
     gggggatctg gagcaggtgc agagccggcg ggggaggggt gccatcccgg tccatgatgg      1380
     tctgctgatt ctttgacacg gtctcacttt gacccctctc tcatcttgct gtttagagat      1440
     ggacttggct catcttgtca aagtctgggc ttttcaaagc tccatctaca aacaatgctg      1500
     ttcttatcct ccgaggggcc tgccagatct ccacctcctt gtagatggag atctgtctag      1560
     gtcattagag ttgcccagaa tctcaatctg gccaccctag agccagggct tggccttttg      1620
     cctattctcc ctttggtctt aggatctgac tattggctga gcctgtccat catgatggat      1680
     tgtgtgctgg tgagctccaa catcatttct actcctacct agcctcctat actggactag      1740
     ggacttctag ggggctaacc taaccaagcc ctggactcca ctttctaaag tgggtctgtc      1800
     ttagccctgc atgtgttttc ccttttcccc agagcattct ctcactctgt cttccgttct      1860
     cagaggttat cagttgcatt gttcccgtta ggtgcttttc tgtagaaggc cattctggaa      1920
     aaaacaataa agtaggtacc acaaccctgt gcccacagaa aaaaaaaaaa aaaaaaaaa       1979
//


spacer
spacer