spacer

EBI Dbfetch

ID   BC096626; SV 1; linear; mRNA; STD; MUS; 1612 BP.
XX
AC   BC096626;
XX
DT   31-MAY-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus chemokine (C-X-C motif) receptor 3, mRNA (cDNA clone
DE   MGC:106368 IMAGE:30749408), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1612
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1612
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-MAY-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4211bba5140f902c73994458809b11c8.
DR   Ensembl-Gn; ENSMUSG00000050232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056614; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Drs. Dennis Taub, Dan Longo and Jonathan Keller
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 208 Row: p Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6753457.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1612
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6NCr"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse Hematopoietic Stem Cell
FT                   (Lin-/c-Kit-/Sca-1+) cDNA Library (Long 1)"
FT                   /clone="MGC:106368 IMAGE:30749408"
FT                   /tissue_type="Hematopoietic stem cell, mouse, ~10 weeks
FT                   old"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1612
FT                   /gene="Cxcr3"
FT                   /note="synonym: Cd183"
FT   misc_difference 1..12
FT                   /gene="Cxcr3"
FT                   /note="12 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             63..1166
FT                   /codon_start=1
FT                   /gene="Cxcr3"
FT                   /product="chemokine (C-X-C motif) receptor 3"
FT                   /db_xref="GOA:O88410"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004070"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1277207"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88410"
FT                   /protein_id="AAH96626.1"
FT                   /translation="MYLEVSERQVLDASDSAFLLENSTSPYDYGENESDFSDSPPCPQD
FT                   FSLNFDRTFLPALYSLLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLT
FT                   LPLWAVDAAVQWVFGPGLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDP
FT                   RVRVALTCIVVWGLCLLFALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAG
FT                   FLLPLLVMAYCYAHILAVLLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMD
FT                   VGVLARNCGRESHVDVAKSVTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQ
FT                   RGPQRQPSSSRRESSWSETTEASYLGL"
FT   misc_difference 109
FT                   /gene="Cxcr3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; amino acid
FT                   difference: 'S' in cDNA, 'F' in the mouse genome."
FT   misc_difference 173
FT                   /gene="Cxcr3"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1583..1612
FT                   /gene="Cxcr3"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1612 BP; 359 A; 460 C; 403 G; 390 T; 0 other;
     aagaggtaat ccgcagcacg agacctgacc ccagcagcca cagccggagc accagccaag        60
     ccatgtacct tgaggttagt gaacgtcaag tgctagatgc ctcggactct gcctttcttc       120
     tggaaaacag cacctctccc tacgattatg gggaaaacga gagcgacttc tcggactccc       180
     cgccctgccc acaggatttc agcctgaact ttgacagaac cttcctgcca gccctctaca       240
     gcctcctctt cttgctgggg ctgctaggca atggggcggt ggctgctgtg ctactgagtc       300
     agcgcactgc cctgagcagc acggacacct tcctgctcca cctggctgta gccgatgttc       360
     tgctggtgtt aactcttcca ttgtgggcag tggatgctgc tgtccagtgg gttttcggcc       420
     ctggcctctg caaagtggca ggcgccttgt tcaacatcaa cttctatgca ggggccttcc       480
     tgctggcttg tataagcttc gacagatatc tgagcatagt gcacgccacc cagatctacc       540
     gcagggaccc ccgggtacgt gtagccctca cctgcatagt tgtatggggt ctctgtctgc       600
     tctttgccct cccagatttc atctacctat cagccaacta cgatcagcgc ctcaatgcca       660
     cccattgcca gtacaacttc ccacaggtgg gtcgcactgc tctgcgtgta ctgcagctag       720
     tggctggttt cctgctgccc cttctggtca tggcctactg ctatgcccat atcctagctg       780
     ttctgctggt ctccagaggc cagaggcgtt ttcgagctat gaggctagtg gtagtggtgg       840
     tggcagcctt tgctgtctgc tggaccccct atcacctggt ggtgctagtg gatatcctca       900
     tggatgtggg agttttggcc cgcaactgtg gtcgagaaag ccacgtggat gtggccaagt       960
     cagtcacctc gggcatgggg tacatgcact gctgcctcaa tccgctgctc tatgcctttg      1020
     tgggagtgaa gttcagagag caaatgtgga tgttgttcac gcgcctgggc cgctctgacc      1080
     agagagggcc ccagcggcag ccgtcatctt cacggagaga atcatcctgg tctgagacaa      1140
     ctgaggcctc ctacctgggc ttgtaattct ggactggaac tgtagcctgc gcagcccaag      1200
     tcctaacaca ctccaagtgc ttgtcctcct tgtagttggg ctagctcgaa cttacccgta      1260
     actttgctgc caggatgcac tgacagctca gcatatatcc aggtctcctg agaatcaatc      1320
     tcagcaacaa ggacaacacc attactgtgc cttagctgcc atgccctatc ttgctgtttt      1380
     agaactagct gcctggagcc ccaccgccct actaaattag caagtagaac tcagccatcc      1440
     ctgtgtgaga agagggagag gcaaatagca cagagggcca ggcgttgtca gcactgaatg      1500
     tgcccatctc agtatctcaa tatttgccca attttatttc tagaaacctc acttaaactt      1560
     tcaataaaca aggtaatgag gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa              1612
//


spacer
spacer