spacer

EBI Dbfetch

ID   BC096587; SV 1; linear; mRNA; STD; MUS; 4147 BP.
XX
AC   BC096587;
XX
DT   31-MAY-2005 (Rel. 84, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus solute carrier family 16 (monocarboxylic acid transporters),
DE   member 2, mRNA (cDNA clone MGC:106394 IMAGE:3992886), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4147
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4147
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-MAY-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 27383dcd27cb06f767ab032176671a17.
DR   Ensembl-Gn; ENSMUSG00000033965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042664; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 208 Row: c Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4147
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:106394 IMAGE:3992886"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4147
FT                   /gene="Slc16a2"
FT                   /note="synonyms: Mct8, Xpct"
FT   CDS             123..1760
FT                   /codon_start=1
FT                   /gene="Slc16a2"
FT                   /product="Slc16a2 protein"
FT                   /db_xref="GOA:Q05BA2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030761"
FT                   /db_xref="MGI:MGI:1203732"
FT                   /db_xref="UniProtKB/TrEMBL:Q05BA2"
FT                   /protein_id="AAH96587.1"
FT                   /translation="MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPEPEPEPEPEPDP
FT                   EPVPVPPPEPQPEPEPQPLPDPAPLPELGFEAEPVQEPEPTPTVETRGTARGFQPPEGG
FT                   FGWIVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFC
FT                   SPIVSIFTDRLGCRITATTGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPS
FT                   LVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLTL
FT                   LSLTYRPLLPSSQDTPSKRGAHTLRQRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAALG
FT                   YFVPYVHLMKYVEDKFKEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLS
FT                   FLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLL
FT                   GMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRD
FT                   SSKDKMLSHDPDPNGELLPGSPTPEEPI"
FT   misc_difference 1799..1800
FT                   /gene="Slc16a2"
FT                   /note="2 bases in cDNA are not found in the mouse genome."
FT   misc_difference 2858^2859
FT                   /gene="Slc16a2"
FT                   /note="1 base in the mouse genome, A, is not found in
FT                   cDNA."
FT   misc_difference 3227..3242
FT                   /gene="Slc16a2"
FT                   /note="16 bases in cDNA are not found in the mouse genome."
FT   misc_difference 4007
FT                   /gene="Slc16a2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 4111..4147
FT                   /gene="Slc16a2"
FT                   /note="polyA tail: 37 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4147 BP; 962 A; 1199 C; 955 G; 1031 T; 0 other;
     ggaggcaggg tctcaggcag ccgcggcggc agtgctcgga gcggcaggag cagtagcagc        60
     agaaacaagt accagccaga caacagctcc tccggcaagc cacagtcagt cccctagccg       120
     cgatggcgct gccaagcccg gcgagcgagg aagctgaggg gccctgtcag gaggcaaacc       180
     aggaatatca ggagccggtg tgtagtcctg tgcccgagcc ggagccagag ccggagcccg       240
     aaccggagcc tgaccccgag ccggtgccag tgcccccgcc cgagcctcag cctgagcccg       300
     agccccagcc cctacccgat cctgcacccc tgccggagct gggctttgag gctgagccag       360
     tgcaagaacc cgagcccacg cccactgtgg aaacccgagg caccgcgcgt ggctttcagc       420
     ctcccgaagg tggcttcggc tggatagtgg tgtttgcagc cacctggtgc aacggctcca       480
     tcttcggcat ccataactct gttggtatcc tctactccat gctactagag gaggaaaaag       540
     agaaaaatcg ccaagtggag ttccaagcag catgggtcgg agccctcgct atgggcatga       600
     tcttcttctg ttctcccatt gtgagtatat tcactgaccg tttgggctgc cgaatcacag       660
     ccaccaccgg ggccgctgtt gctttcattg gcctccacac cagctccttc accagctccc       720
     taagcctgcg ctacttcacc tatgggattc tgtttggttg tggctgctca ttcgcctttc       780
     aaccatcact cgtcatcctg ggccactact ttcaacgtcg cctaggtcta gccaatggtg       840
     tggtatctgc tggaagtagc atcttctcca tgtcttttcc cttcctcatc aaaatgctgg       900
     gggataaaat caagctggcc caaaccttcc aggtgctgag taccttcatg tttgtcctta       960
     cgctgctctc actcacttac cggcccctcc tgccaagctc ccaggacacc ccaagcaaga      1020
     gaggtgccca caccctgcga cagcgctttc tggttcagtt cagaaagtac ttcaacatgc      1080
     gtgtattccg ccagcgcact taccgtatct gggcctttgg gatcgctgct gctgcccttg      1140
     gttacttcgt cccctacgtg cacctgatga aatatgtgga agataagttc aaggagatca      1200
     aggagacctg ggtgctcttg gtgtgcattg gggctacgtc aggcctcgga cgtctcgtct      1260
     cgggccacat cagtgactcc atccctggac ttaagaagat atacttgcag gtcctctcat      1320
     tcctgctcct gggcttgatg tccatgatga tccccctatg ccgggacttc gggggcctta      1380
     tcgttgtctg cctcttcctg ggcctatgtg atggcttctt cattaccatc atggctccca      1440
     ttgcatttga gctggtggga cccatgcagg cctcacaggc cattggctac ctcctgggca      1500
     tgatggccct gccaatgatt gctgggcccc ccattgcagg cctccttcga aactgctttg      1560
     gtgattacca tgtggccttc tactttgcgg gtgtcccccc aatcattgga gctgtgatcc      1620
     ttttcttcgt ccctctgatg catcaaagga tgtttaagaa agagcagaga gattccagca      1680
     aggataagat gctgtcccac gatccagacc ccaacggaga actgctgcca ggctccccaa      1740
     cacctgaaga gcccatttaa tgcctctgtc ttgccattgt gtgctccttc cccccccccc      1800
     actccacccc tcatcctacc ctgcttagca tttacatttt ttgccaccag cacacttgtt      1860
     cccaaacctg tgcacacagc atttcagcca cctgaccatc tcctctgagc caatgctctc      1920
     ggtgttccaa actcattaac caaattctcc ccatgaatgc cttgaaactt gccaggctct      1980
     tctcccagaa tctgggaaag tgtgggatca ccccctggcc tttggatcct cccccatata      2040
     tactttctaa ctctttgcgg ggaggacagg gatgggatct ctagccccag attgttagtc      2100
     acccactaca atcaattgcc aaaggtgcta ctgtgtcccc agaacccagt gagacagacc      2160
     taagcctctg tttgctgagg aatttgttgc catccatcct tgggaaccat ttgggaattg      2220
     tgagaaggaa ggccaaagga gaccaggagc cttgttttgc atcgaagctc ctgaggactc      2280
     tgcggcaccc catcatatgg ttggttagcc gtctgcttcc cttttccttt cctagtattt      2340
     tctctctact tcctcttctc cgatttcttc ccctctattc ctttttatta gtgtcatgac      2400
     acataggtgc ttggagaaag gaaagaccca gagcttgggc caatccactt cattctgacc      2460
     cagaccatcc ctaatattag cattaatact gctcatctca ggttgagcta catctcactt      2520
     tctgggctca aactgatatg gactggaaga gcaggctatc gcatagggat gggaatcttc      2580
     aacactacag agttccatgt accagtcact gattttgaca gattaaccaa gaggccttcc      2640
     cagtttccca tccttcccac ctgtcaaatg tgaagaaact cttctcatct catgaaacac      2700
     aggaggaaag atgtcagtgc actggcatta gaggagatgc tacggttaac ggtttgggga      2760
     aggaccaact cctccgtctc tcatttttca taagaggtca atatttccac ctgggccagg      2820
     ccaagaaatg aactgcttta aggaaaaaaa aaaaaaaacc tcattctgta cctggatctc      2880
     caaatgacat aggcaacaac tgcacgtagg ggttggataa tttcttttca gaaggggaag      2940
     ccaccctagc ctttaccacc cacccagtct gtcccccatt ctaggcatcc tggaccactc      3000
     tgctgagtgg gcattatagg tgccagaaaa agtaggctct ggaccaccat catccctttg      3060
     aagttggtgc cagatatttt cctacatcca ggctctgggc aacagtctta ctgaagcaca      3120
     ttccaagtgc ccctggccag aggcaaaggg cactgccagc ctcgtccagt tgtacggctc      3180
     acctcattag ggactcagcc tctctcctcc ctgtttctct ctctctctgt gtctctctct      3240
     ctgtctttgt ttattgtgtt cctgtaccaa ccttttatca tctttttgcc aggcatcctg      3300
     gctgttactt ggacccaaca ataacttgcc accccaagct agggtcatcc caaggccagg      3360
     aagatgaggt tgctctgagg ggctccaaag aatacaatgg tccccacaca tgagtttttc      3420
     cgttactaac aggcagctgg ggcatagttg gcctctgatg tttcattcaa ggccaaagtc      3480
     ctgagccccc ctctgctggt cccaatccag ctcttatcaa ctccccaaag gaaaacccat      3540
     tggttcttgg ctctgaggac aggaaggggt ggagtcactg tcctgtcaac tcaagcatct      3600
     atggaacagg agaagctggg ccccaggagc cctgcgactc ccaggagagg ccattgaaaa      3660
     tactgaagca acaatgcttc cacttccatt tctccttacc ccaccccctc caggccactt      3720
     agggggtagg gggcagaata agtgtgcagg gcctcctttg ttgctcatgg ctggacagct      3780
     ctaaagagtc aggctgccac tcacttctct ccagatgatg gaaagacatt cacaggtccc      3840
     agatctgccc attcaggtgt cacctaacat tggcagggtg tcaatttact tttttatttt      3900
     tcacaaatgc gtgtgtgcac gtgtgggctt gtgtgctttc cgagagaatg ttgtttggcc      3960
     aaagcagcac agtattaata tttagagtag gaagcagcct cttaggcacc acagttaaaa      4020
     actaagagaa cgaacaaaat ttcagagctt gagacctggg acatttaaat cctcaagggg      4080
     tttggaacaa aataaacaga tctaaatgtc aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      4140
     aaaaaaa                                                                4147
//


spacer
spacer