spacer

EBI Dbfetch

ID   BC096379; SV 1; linear; mRNA; STD; MUS; 4006 BP.
XX
AC   BC096379;
XX
DT   21-MAY-2005 (Rel. 83, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus chloride channel calcium activated 5, mRNA (cDNA clone
DE   MGC:106131 IMAGE:5317084), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4006
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4006
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (17-MAY-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3c2488e31f5d55c2417af54543b224f1.
DR   Ensembl-Gn; ENSMUSG00000036960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040465; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Chu-Xia Deng Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 208 Row: h Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31581561.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4006
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="129,C57BL/6J,FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam3"
FT                   /clone="MGC:106131 IMAGE:5317084"
FT                   /tissue_type="Mammary tumor. Brca1-/fl; MMTV-Cre model. 10
FT                   months old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4006
FT                   /gene="Clca5"
FT                   /note="synonym: 4732440A06"
FT   CDS             141..2969
FT                   /codon_start=1
FT                   /gene="Clca5"
FT                   /product="chloride channel calcium activated 5"
FT                   /db_xref="GOA:Q8BG22"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004727"
FT                   /db_xref="InterPro:IPR013642"
FT                   /db_xref="InterPro:IPR015394"
FT                   /db_xref="MGI:MGI:2139758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG22"
FT                   /protein_id="AAH96379.1"
FT                   /translation="MTHRDSTGPVIGLKLVTLLFTLSPELLFLGAGLKLKENGYDGLLV
FT                   AINPRVPEDLKLITNIKEMITEASFYLFNATKRRVFFRNVQILVPATWTDHNYSRVRQE
FT                   SYDKANVIVAEQSEEHGDDPYTLQHRGCGQEGRYIHFTPSFLLNDELAAGYGARGRVFV
FT                   HEWAHLRWGVFDEYNNDKPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKIF
FT                   REGCTFLYNSTQNATGSIMFMPSLPSVVEFCNESTHNQEAPNLQNQVCSLRSTWDVITA
FT                   SSDLNHSLPVHGVGLPAPPTFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELYLM
FT                   QVVEAHTFVGIVTFDSKGEIRASLQQIYSDDDRKLLVSYLPTAVSTDAETNICAGVKKG
FT                   FEVVEERNGRADGSVLILVTSGADEHIANCLLTSMNSGSTIHSMALGSSAARKVGELSR
FT                   LTGGLKFFIPDKFTSNGMTEAFVRISSGTGDIFQQSLQVESVCETVQPQHQLADTMTVD
FT                   SAVGNDTLFLVTWQTGGPPEIALLDPSGRKYNTGDFIINLAFRTASLKIPGTAKHGHWT
FT                   YTLNNTHHSPQALKVTVASRASSLAMSPATLEAFVERDSTYFPQPVIIYANVRKGLHPI
FT                   LNATVVATVEPEAGDPVVLQLLDGGAGADVIRNDGIYSRYFSSFAVSGSYSLTVHVRHS
FT                   PSTSTLALPVPGNHAMYVPGYITNDNIQMNAPKNLGHRPVKERWGFSRVSSGGSFSVLG
FT                   VPDGPHPDMFPPCKITDLEAMKVEDDVVLSWTAPGEDFDQGQTTSYEIRMSRSLWNIRD
FT                   DFDNAILVNSSELVPQHAGTRETFTFSPKLVTHELDHELAEDAQEPYIVYVALRAMDRS
FT                   SLRSAVSNIALVSMSLPPNSSPVVSRDDLILKGVLTTVGLIAILCLIMVVAHCIFNRKK
FT                   RPSRKENETKFL"
FT   misc_difference 3987..4006
FT                   /gene="Clca5"
FT                   /note="polyA tail: 20 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4006 BP; 1167 A; 905 C; 919 G; 1015 T; 0 other;
     ggttttcaaa gaaggcaact cctcatcatg tattgtaaga ccttctaagt tccgaaagaa        60
     gccagctgct tccacattga tcagctgact caaggtaccc agcaggctcc ccgtgaataa       120
     accagaggtt tcactgcaag atgacccaca gggacagcac aggacctgtc atcgggctga       180
     aacttgtgac ccttctgttc accctaagtc cagaacttct gttcctggga gctggattga       240
     agctgaaaga gaatggctat gatggattgc ttgttgccat caatccccgg gtacccgagg       300
     atctgaagct gattacaaac attaaggaaa tgataaccga agcttccttt tacctgttca       360
     atgcgaccaa gaggagggtg tttttcagaa atgtacagat tttagtacct gccacttgga       420
     cggatcataa ttacagtaga gtaagacaag aatcctatga caaggcaaat gtcatagtgg       480
     ctgagcagag tgaggaacac ggagatgatc cctacaccct acagcacaga gggtgtgggc       540
     aagaggggag atacatccac ttcaccccca gcttcctact caacgatgag ttagccgcag       600
     gctatggtgc gcgaggcaga gtgtttgtcc acgagtgggc ccatctccgc tggggtgtgt       660
     tcgatgaata taacaacgac aaaccgttct acgtgaatgg acggaatgag attcaagtca       720
     ccaggtgttc atctgacatt acaggcgttt ttgtgtgtga aaagggcctc tgcccccatg       780
     aagactgcat tattagcaag atttttaggg aaggatgcac attcctctac aacagcaccc       840
     agaatgcaac tggatcaata atgttcatgc caagtttacc ttctgtggtt gaattctgta       900
     acgaaagtac acacaaccaa gaagctccaa acctccagaa ccaagtgtgc agcctcagaa       960
     gcacttggga cgtgatcaca gcctcctccg acctgaacca tagcctcccc gtgcatgggg      1020
     ttggacttcc agcccctccc acgttctccc tcttgcaggc tggtgaccga gtggtctgct      1080
     tagtgattga tgtgtccagg aagatggcag agggagacag actgctccga cttcaacaag      1140
     cagccgaact gtacttgatg caggttgtcg aagctcacac tttcgtgggc attgtcactt      1200
     ttgatagcaa aggagaaatc cgagcctcgc tgcagcaaat ttacagtgac gatgaccgga      1260
     agctgctggt ttcatacctg ccgaccgccg tgtccactga cgcagaaacg aacatctgtg      1320
     caggggttaa gaaaggcttt gaggtggttg aggagcggaa tggaagagct gacggctctg      1380
     tcctgatatt agtgaccagt ggagcagatg aacacattgc caactgcctg ctcacctcga      1440
     tgaacagtgg atccaccatt cactccatgg ccctgggttc ctctgcagcc agaaaagtgg      1500
     gggaattatc acgtcttaca ggaggtctaa agttcttcat tccagataaa tttacttcta      1560
     atggaatgac tgaagctttc gttcgaatct cttctggaac aggagacatt ttccagcaaa      1620
     gcttacaggt tgagagcgtg tgcgaaactg tgcaacccca gcaccagctg gcggatacta      1680
     tgactgtgga tagcgccgtg ggcaatgaca cactttttct agtcacgtgg cagactggtg      1740
     gcccccctga gattgcatta ttggatccta gcggaagaaa atacaacact ggtgacttta      1800
     tcatcaacct ggcctttcgg acagccagcc ttaagattcc agggacagct aagcatgggc      1860
     actggactta cacgctgaac aacacccacc attctcccca agctctgaaa gtgacagtgg      1920
     cctctcgtgc ctccagcctg gccatgtccc cagccactct ggaagccttt gtggaaagag      1980
     acagcaccta ttttcctcag ccagtgatca tttatgcgaa tgtgaggaaa ggtctgcatc      2040
     ccattctcaa tgccaccgtg gtggcgacag tggaaccaga ggctggagat cccgttgtac      2100
     tgcaactttt ggatggcgga gcaggtgcag atgttataag aaatgatggg atttactcca      2160
     ggtatttttc ctcctttgct gtaagtggta gctatagcct gacagtgcat gtccgtcact      2220
     ctcccagcac aagcacacta gccctccctg tcccaggaaa ccatgctatg tatgtaccag      2280
     gttacataac aaacgataat attcaaatga atgctcccaa aaacttgggc cacagacctg      2340
     tgaaggagag gtggggcttc agtcgagtga gctcgggagg ctccttctcc gtgctgggag      2400
     tcccagacgg cccccaccct gacatgtttc caccgtgcaa aattactgac ctggaagcca      2460
     tgaaagtgga agacgacgtc gtcctctctt ggacggcacc tggggaagac ttcgatcagg      2520
     ggcaaactac aagctatgaa ataagaatga gcagaagcct atggaacatt cgggatgact      2580
     ttgacaatgc catcttggtg aattcgtcag agctagttcc tcagcatgct ggcaccaggg      2640
     agacatttac attctcaccc aagcttgtca cccatgaact tgatcatgaa cttgctgaag      2700
     atgcacaaga accctacata gtgtatgtgg ccctgagagc catggataga agctccctca      2760
     ggtcagctgt gtcaaacatt gccctggtat caatgtctct tcctccaaac tcttctcctg      2820
     tagtgagcag agatgatctg atcctgaaag gagttttaac aacagtaggt ttgatagcaa      2880
     tcctttgcct tattatggtt gtagcacact gtatttttaa caggaaaaag agaccatcaa      2940
     gaaaagagaa tgagacaaaa tttctatgaa caagcaggca cagtatcttc cttcttaggt      3000
     aggatggaca tgacctttac atccacaaaa taaaatgtga acaaaatcaa aatagtctcg      3060
     acatggggac ttttacataa tgcaaaaatg ccctcccccc ccccccaaaa aaaacccacc      3120
     aacttttaac tcattttggg aaagggttag aaaacagtgt aaggttccag ttatggaaaa      3180
     ataataaaat atattgctca aggtaatggc ttgaaaggca aaggaagaac aaaatcaaat      3240
     cgagtcaaga aaagcttgtt ttattgaagt tcaggttggg ggaagttctg ggtacagaaa      3300
     agaatgttgg gtcttagtta gacagtgtaa ctatctgtat gatgcaaaca tgttactttg      3360
     atgaatttct catctctgct tatctgtgca gagaaggaca catgtttata ctgacaacca      3420
     agctgcttta tagaagaggc catactacag ggttctttat atcttgtcct ttggttaaat      3480
     tcactgtggc tcacaagaca ccactaaagt tcagatagga cttttctcac catgagagga      3540
     gaccttagaa tgcaattgtt gtccttgtcc cttggatact gatctgtagc agaggtcacc      3600
     ggagtttact gtttgtaaga cgttagtgcc attgaagcag ctttctaagt tattggcttg      3660
     gaagtattga atgaaaatgg ttacggctcc catgaggctt tacaggtaaa agacattatg      3720
     ctgaaataat tttaatatat acaccatata gttttattcc atctcaaata agaagtcatg      3780
     gaaacaatta gcaaattctg ccccggttta ataagtacat gcaattcttt tcttcatcaa      3840
     ggacacagag aagacagcag agaaaatgtg gaaataaaaa tcatctaatg ctacttcttc      3900
     cttttaaaaa atgttattta ataatattat gtcatttcta aattcaagaa cttaaaggtt      3960
     tattgaataa atattatgtt acagataaaa aaaaaaaaaa aaaaaa                     4006
//


spacer
spacer