spacer

EBI Dbfetch

ID   BC094603; SV 1; linear; mRNA; STD; MUS; 2118 BP.
XX
AC   BC094603;
XX
DT   10-MAY-2005 (Rel. 83, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 4,
DE   mRNA (cDNA clone MGC:106499 IMAGE:6828002), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2118
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2118
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-MAY-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 21eb9048660734534e1af6a32498ce1f.
DR   Ensembl-Gn; ENSMUSG00000029211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031121; mus_musculus.
DR   RFAM; RF01803; GABA3.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 205 Row: h Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 33468894.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2118
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FD0"
FT                   /clone="MGC:106499 IMAGE:6828002"
FT                   /tissue_type="Brain, mouse 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2118
FT                   /gene="Gabra4"
FT   CDS             128..1786
FT                   /codon_start=1
FT                   /gene="Gabra4"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit alpha 4"
FT                   /db_xref="GOA:Q543Z0"
FT                   /db_xref="InterPro:IPR001390"
FT                   /db_xref="InterPro:IPR005434"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95616"
FT                   /db_xref="UniProtKB/TrEMBL:Q543Z0"
FT                   /protein_id="AAH94603.1"
FT                   /translation="MVSVQKVPAIALCSGVSLALLHFLCLAACLNESPGQNSKDEKLCP
FT                   ENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWI
FT                   DKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYT
FT                   MRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLV
FT                   QYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWIN
FT                   KESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAV
FT                   NYFTNIQMQKAKKKISKPPPEVPAAPVLKEKHTETSLQNTHANLNMRKRTNALVHSESD
FT                   VKSRTEVGNHSSKTSAVQESSEATPKAHLASSPNPFSRANAAETMSAAARGLSSAASPS
FT                   PHGTLRPASLGSASTRPAFGSRLGRIKTTVNTTGAAGNVSATPPPPAPPPSGSGTSKID
FT                   KYARILFPVTFGAFNMVYWVVYLSKDTMEKSESLM"
FT   misc_difference 2113..2118
FT                   /gene="Gabra4"
FT                   /note="polyA tail: 6 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2118 BP; 615 A; 463 C; 467 G; 573 T; 0 other;
     cgcgggcgag tgtgagcgcg agtgtgcgca cgccgcggga gccactctgc cctctcctcg        60
     caccctgccc agggcatctc gagaggctgg aaacgtgaac aggcttaaag tatggcatgt       120
     tgcgaagatg gtttctgtcc agaaggtacc cgcgattgcg ctgtgctccg gggtcagcct       180
     cgccctcctg cacttcctgt gcctggcggc ttgtttaaac gaatccccag gacagaactc       240
     aaaggacgag aaattgtgcc cggaaaattt tacccgtatt ctggacagtt tgctggatgg       300
     ttatgacaac aggctgcgtc ctggatttgg gggtcctgtt acagaagtga aaactgatat       360
     atatgtcacc agctttgggc ccgtttctga tgttgaaatg gaatacacta tggatgtgtt       420
     cttcagacag acatggattg acaaaagact aaaatatgac ggcccaattg aaatcttgag       480
     gctgaataat atgatggtca ccaaagtttg gacccctgat actttcttca ggaatggaaa       540
     gaaatctgtc tcacataaca tgacagctcc aaataagctt tttagaatta tgagaaatgg       600
     cactatttta tacacaatga gactcaccat aagtgcggag tgccccatga gactggtgga       660
     ttttcctatg gatggtcatg cctgcccttt gaaatttggg agttatgcat atcccaaaag       720
     tgagatgatc tacacctgga ccaaaggccc tgagaagtca gtggaggtgc caaaggagtc       780
     ttctagctta gttcaatatg acctcattgg gcagactgta tcaagcgaga ctatcaaatc       840
     tattacaggt gaatacattg ttatgacggt ttacttccac ctcagacgga agatgggcta       900
     ctttatgatt cagacgtata tcccatgcat catgacagtg attctttctc aagtttcctt       960
     ctggataaac aaggagtctg ttccagctag aactgtattt ggaataacca cagtcctcac      1020
     gatgaccacc ctaagcatca gtgctcggca ttctttgccc aaagtgtcct atgcgactgc      1080
     catggattgg ttcatagctg tctgttttgc ttttgtattt tcggctctta ttgagtttgc      1140
     tgctgtcaac tatttcacca acattcaaat gcagaaagcc aaaaagaaga tatcaaagcc      1200
     tcccccagaa gttccagctg ctcctgtgct gaaggagaaa cacacagaaa catcccttca      1260
     gaatacacat gccaatttga acatgaggaa aagaacaaat gccttggtcc attcagaatc      1320
     ggatgtcaaa agcagaactg aggtgggaaa tcactccagc aagaccagcg ctgtccagga      1380
     gtcttctgaa gccacgccta aggctcactt agcttccagt ccaaatccat tcagcagggc      1440
     aaatgcagct gagactatgt ctgctgcagc cagaggtctt tcatctgcag catccccctc      1500
     tcctcatggc acattgcggc cagcttcttt ggggtcagct tccactcgcc ctgcatttgg      1560
     atctagactt gggcgaatta agacaacagt taatacaaca ggggctgctg ggaatgtgtc      1620
     agccacacct cctccccctg ctccaccgcc ttctggatct ggcacaagta aaatagacaa      1680
     atatgctcgt attctctttc cagtcacatt tggagcattt aacatggtct actgggttgt      1740
     ttatttatct aaggacacca tggagaaatc agaaagtcta atgtaatttt gttgctatag      1800
     taatttcata acaacgatgg aaatacagac tgtcttttaa aatgttttta aaggtaagta      1860
     ttctttacta aaataaaaat tctatgtaat tttttcactt aaaaaaatac aagtcagata      1920
     tggagagagt taattaactc ttcagtggct agaaagtgaa ccatctttct ttatagaaag      1980
     atagctttaa aagaatctat tcagtgttca aattggatag aacacagagc attatggaaa      2040
     gttggagcaa gagaaataga gctaggagag atatgtggta cacccttttg cattgaaatt      2100
     tgaaaaaaaa aaaaaaaa                                                    2118
//


spacer
spacer