spacer

EBI Dbfetch

ID   BC094357; SV 1; linear; mRNA; STD; MUS; 1110 BP.
XX
AC   BC094357;
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus cofilin 1, non-muscle, mRNA (cDNA clone MGC:106530
DE   IMAGE:6820355), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1110
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1110
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7cd3261097174795fb69cbfd3ea22222.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116560; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 205 Row: g Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542381.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FX0"
FT                   /clone="MGC:106530 IMAGE:6820355"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1110
FT                   /gene="Cfl1"
FT                   /note="synonym: cofilin"
FT   CDS             56..556
FT                   /codon_start=1
FT                   /gene="Cfl1"
FT                   /product="cofilin 1, non-muscle"
FT                   /db_xref="GOA:Q544Y7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y7"
FT                   /protein_id="AAH94357.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
FT   misc_difference 1064^1065
FT                   /gene="Cfl1"
FT                   /note="5 bases in the mouse genome, CAAAA, are not found in
FT                   cDNA."
FT   misc_difference 1092..1110
FT                   /gene="Cfl1"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1110 BP; 281 A; 310 C; 266 G; 253 T; 0 other;
     tgcggcggct caggtcttca gttgctcttt ctgtctccct ttcgtttccg gaaacatggc        60
     ctctggtgtg gctgtctctg atggtgtcat caaggtgttc aatgacatga aggttcgcaa       120
     gtcttcaaca ccagaagaag tgaagaaacg caagaaggcg gtgctctttt gcctgagtga       180
     ggacaagaag aacatcatcc tggaggaggg caaggagatc ctggtaggag atgtggggca       240
     gactgtggac gacccctaca ccacttttgt caagatgctg ccagacaagg actgccgcta       300
     tgcactctat gatgcaacct atgagaccaa ggagagcaag aaggaggacc tggtgttcat       360
     cttctgggcc cccgagaatg cacccctcaa gagcaaaatg atctatgcca gctccaagga       420
     tgccatcaag aagaagctga caggaatcaa gcatgaatta caagctaact gctacgagga       480
     ggtcaaggac cgctgcaccc tggcagagaa actaggtggc agcgccgtca tttccctgga       540
     gggcaagcct ttgtgagcca cctccagccc cctgcctgga gcatcttaac agccccagac       600
     ctgctcttgg gtgttgcagg ctgccccttt cctgccagac cggaggggct ggggggatcc       660
     cagcaggggg agggctatcc cttcacccca gttgccaaac atccctccca ccccctggac       720
     cgtccttctc cctccatccc tgacggttct ggccttccca aactgctttt gatcttctga       780
     ttcctcttgg gttgacgcag accaagtccc gtcctaggca cccagtttgg ggggagcctg       840
     tatttttttt tttaacgaca cccctactcc gtatccctcc ccatcccatg ctgccaactt       900
     ctaaccacaa tagtgactct gtgcttgtct gtttagttct gtgtgtaaat gaaatgtgga       960
     aatgaccctc cctgccccag ctggctgccc tcccctttcc tttgatcttg accactcatg      1020
     gaagcaggac cagtaaggga ccttcaattt aaaacaaaac aaaaaaacaa taaaaaggct      1080
     aattaacaac aaaaaaaaaa aaaaaaaaaa                                       1110
//


spacer
spacer